From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003477000
  • symbol?:
  • description?: ribosomal large subunit psudouridine synthase D

      descriptions from strain specific annotations:

    • ribosomal large subunit psudouridine synthase D
    • RluA family pseudouridine synthase
    • ribosomal large subunit pseudouridine synthase D
    • pseudouridylate synthase
    • putative RNA pseudouridylate synthase
    • RluD subfamily ribosomal large subunit pseudouridine synthase
    • Pseudouridine synthase
    • pseudouridylate synthase RluD
  • strand?: +
  • coordinates?: 3816163..3817080
  • synteny block?: BlockID0025560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1155
    08BA02176:
    C248_1226
    11819-97:
    MS7_1154
    71193:
    ST398NM01_1194
    ECT-R 2:
    ECTR2_1052
    ED133:
    SAOV_1200
    ED98:
    SAAV_1168
    HO 5096 0412:
    SAEMRSA15_10300
    JH1:
    SaurJH1_1281
    JH9:
    SaurJH9_1256
    JKD6008:
    SAA6008_01151 (rluD)
    JKD6159:
    SAA6159_01050 (rluD)
    LGA251:
    SARLGA251_11080
    M013:
    M013TW_1132
    MRSA252:
    SAR1173
    MSHR1132:
    SAMSHR1132_10380
    MSSA476:
    SAS1131
    Mu3:
    SAHV_1187
    Mu50:
    SAV1197
    MW2:
    MW1080
    RF122:
    SAB1061
    ST398:
    SAPIG1194 (rluD)
    T0131:
    SAT0131_01244
    TCH60:
    HMPREF0772_12035 (rluD)
    TW20:
    SATW20_11910
    USA300_TCH1516:
    USA300HOU_1134 (rluD)
    VC40:
    SAVC_05150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
    N315            METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
    NCTC8325        METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
    Newman          METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
    USA300_FPR3757  METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
                    ************************************************************

    COL             HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
    N315            HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
    NCTC8325        HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
    Newman          HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
    USA300_FPR3757  HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
                    ************************************************************

    COL             KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
    N315            KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
    NCTC8325        KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
    Newman          KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
    USA300_FPR3757  KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
                    ************************************************************

    COL             HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
    N315            HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
    NCTC8325        HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
    Newman          HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
    USA300_FPR3757  HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
                    ************************************************************

    COL             MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
    N315            MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
    NCTC8325        MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
    Newman          MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
    USA300_FPR3757  MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTSEYIERHAELPQDFEDLLDTI
                    ***************************************.********************

    COL             RKRDA
    N315            RKRDA
    NCTC8325        RKRDA
    Newman          RKRDA
    USA300_FPR3757  RKRDA
                    *****