From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004783000
  • symbol?:
  • description?: RNA pseudouridine synthase

      descriptions from strain specific annotations:

    • RNA pseudouridine synthase
    • ribosomal large subunit pseudouridine synthase D
    • RNA pseudouridylate synthase
    • ribosomal large subunit pseudouridine synthase, RluD subfamily
    • ribosomal large subunitpseudouridine synthase D-like protein
    • RluA, Pseudouridylate synthase, 23S RNA-specific
    • RluA, Pseudouridylate synthases, 23S RNA-specific
    • RNA pseudouridylate synthase family protein
    • truncated ribosomal large subunit pseudouridine synthase D, RluD subfamily
  • strand?: +
  • coordinates?: 4992994..4993428
  • synteny block?: BlockID0037150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1806 (yhcT)
    08BA02176:
    C248_1893
    11819-97:
    MS7_1855
    71193:
    ST398NM01_1916
    ECT-R 2:
    ECTR2_1692
    ED133:
    SAOV_1847
    ED98:
    SAAV_1869
    HO 5096 0412:
    SAEMRSA15_17550
    JH1:
    SaurJH1_1938
    JH9:
    SaurJH9_1904
    JKD6008:
    SAA6008_01807 (rluA)
    JKD6159:
    SAA6159_01778 (rluA)
    LGA251:
    SARLGA251_17330
    M013:
    M013TW_1856
    MRSA252:
    SAR1941
    MSHR1132:
    SAMSHR1132_16960
    MSSA476:
    SAS1771
    Mu3:
    SAHV_1835
    Mu50:
    SAV1850
    MW2:
    MW1791
    RF122:
    SAB1783
    ST398:
    SAPIG1916
    T0131:
    SAT0131_01970
    TCH60:
    HMPREF0772_11294
    TW20:
    SATW20_18440
    USA300_TCH1516:
    USA300HOU_1844 (rluA2)
    VC40:
    SAVC_08486

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
    N315            MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
    NCTC8325        MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
    Newman          MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
    USA300_FPR3757  MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
                    ************************************************************

    COL             IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
    N315            IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
    NCTC8325        IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
    Newman          IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
    USA300_FPR3757  IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
                    ************************************************************

    COL             IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
    N315            IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
    NCTC8325        IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
    Newman          IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
    USA300_FPR3757  IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
                    ************************************************************

    COL             FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
    N315            FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
    NCTC8325        FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
    Newman          FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
    USA300_FPR3757  FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
                    ************************************************************

    COL             YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
    N315            YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
    NCTC8325        YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
    Newman          YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
    USA300_FPR3757  YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
                    *********************************