From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1436 [new locus tag: NWMN_RS08105 ]
  • pan locus tag?: SAUPAN004109000
  • symbol: NWMN_1436
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1436 [new locus tag: NWMN_RS08105 ]
  • symbol: NWMN_1436
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1606764..1606982
  • length: 219
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGCGTAATATAATATTTTATCTTGTACTTATTATTGCTGCGATTGGATTAGTAATGAAT
    CTAGATGCCTTTATTTTTTCAATCGTCAGAATGTTAATCAGCTTTGCTGTAATAGCTGGT
    ATTATTTATCTGATTTATTATTTCTTCATCTTAACTGAAGACCAACGCAAATATCGCAAA
    GCAATGCGTAAGTATAAAAGAAATCAAAGAAGAAAATAG
    60
    120
    180
    219

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1436 [new locus tag: NWMN_RS08105 ]
  • symbol: NWMN_1436
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 11.08
  • theoretical MW: 8728.64
  • GRAVY: 0.593056

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssB (TIGR03926; HMM-score: 15.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, YajC subunit (TIGR00739; HMM-score: 14.8)
    Cellular processesCellular processesToxin production and resistancebacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 12.7)
    integral membrane protein (TIGR04561; HMM-score: 8)
  • TheSEED:  
    FIG01107940: hypothetical protein 
  • PFAM:
    no clan definedOrf78; Orf78 (ac78) (PF06024; HMM-score: 21.2)
    PrgI; PrgI family protein (PF12666; HMM-score: 15.4)
    PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 14.7)
    no clan definedYitT_membrane; Uncharacterised 5xTM membrane BCR, YitT family COG1284 (PF02588; HMM-score: 14.2)
    IncA; IncA protein (PF04156; HMM-score: 13.6)
    MIM-OM_import (CL0455) TIM21; TIM21 (PF08294; HMM-score: 13.5)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 12.9)
    no clan definedDUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 12.7)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 11.6)
    no clan definedCOX6C; Cytochrome c oxidase subunit VIc (PF02937; HMM-score: 10.5)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 10)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 9.7)
    DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 6.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 11
    • Cmax: 0.171
    • Cmax_pos: 26
    • Smax: 0.294
    • Smax_pos: 1
    • Smean: 0.219
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRKAMRKYKRNQRRK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]