From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004109000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 4385372..4385617
  • synteny block?: BlockID0031390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1490
    08BA02176:
    C248_1574
    11819-97:
    MS7_1549
    71193:
    ST398NM01_1597
    ECT-R 2:
    ECTR2_1383
    ED133:
    SAOV_1532
    ED98:
    SAAV_1524
    HO 5096 0412:
    SAEMRSA15_14520
    JH1:
    SaurJH1_1623
    JH9:
    SaurJH9_1590
    JKD6008:
    SAA6008_01501
    JKD6159:
    SAA6159_01467
    LGA251:
    SARLGA251_14380
    M013:
    M013TW_1547
    MRSA252:
    SAR1609
    MSHR1132:
    SAMSHR1132_13720
    MSSA476:
    SAS1470
    Mu3:
    SAHV_1519
    Mu50:
    SAV1532
    MW2:
    MW1484
    RF122:
    SAB1404
    ST398:
    SAPIG1597
    T0131:
    SAT0131_01625
    TCH60:
    HMPREF0772_11609
    TW20:
    SATW20_15280
    USA300_TCH1516:
    USA300HOU_1533
    VC40:
    SAVC_06905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRK
    N315            MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRK
    NCTC8325        MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRK
    Newman          MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRK
    USA300_FPR3757  MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRK
                    ************************************************************

    COL             AMRKYKRNQRRK
    N315            AMRKYKRNQRRK
    NCTC8325        AMRKYKRNQRRK
    Newman          AMRKYKRNQRRK
    USA300_FPR3757  AMRKYKRNQRRK
                    ************