From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01628
  • pan locus tag?: SAUPAN004109000
  • symbol: SAOUHSC_01628
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01628
  • symbol: SAOUHSC_01628
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1549965..1550183
  • length: 219
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGCGTAATATAATATTTTATCTTGTACTTATTATTGCTGCGATTGGATTAGTAATGAAT
    CTAGATGCCTTTATTTTTTCAATCGTCAGAATGTTAATCAGCTTTGCTGTAATAGCTGGT
    ATTATTTATCTGATTTATTATTTCTTCATCTTAACTGAAGACCAACGCAAATATCGCAAA
    GCAATGCGTAAGTATAAAAGAAATCAAAGAAGAAAATAG
    60
    120
    180
    219

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01628
  • symbol: SAOUHSC_01628
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 11.08
  • theoretical MW: 8728.64
  • GRAVY: 0.593056

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssB (TIGR03926; HMM-score: 15.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, YajC subunit (TIGR00739; HMM-score: 14.8)
    Cellular processesCellular processesToxin production and resistancebacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 12.7)
    integral membrane protein (TIGR04561; HMM-score: 8)
  • TheSEED:  
    FIG01107940: hypothetical protein 
  • PFAM:
    no clan definedOrf78; Orf78 (ac78) (PF06024; HMM-score: 21.2)
    PrgI; PrgI family protein (PF12666; HMM-score: 15.4)
    PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 14.7)
    no clan definedYitT_membrane; Uncharacterised 5xTM membrane BCR, YitT family COG1284 (PF02588; HMM-score: 14.2)
    IncA; IncA protein (PF04156; HMM-score: 13.6)
    MIM-OM_import (CL0455) TIM21; TIM21 (PF08294; HMM-score: 13.5)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 12.9)
    no clan definedDUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 12.7)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 11.6)
    no clan definedCOX6C; Cytochrome c oxidase subunit VIc (PF02937; HMM-score: 10.5)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 10)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 9.7)
    DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 6.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 11
    • Cmax: 0.171
    • Cmax_pos: 26
    • Smax: 0.294
    • Smax_pos: 1
    • Smean: 0.219
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRKAMRKYKRNQRRK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]