From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01627
  • pan locus tag?: SAUPAN004108000
  • symbol: SAOUHSC_01627
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01627
  • symbol: SAOUHSC_01627
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1549370..1549951
  • length: 582
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAATTGGTTTCAATTGTTGGCGCAACATTATTGTTAGCTGGATGTGGATCACAA
    AATTTAGCACCATTAGAAGAAAAAACAACAGATTTAAGAGAAGATAATCATCAACTCAAA
    CTAGATATTCAAGAACTTAATCAACAAATTAGTGATTCTAAATCTAAAATTAAAGGGCTT
    GAAAAGGATAAAGAAAACAGTAAAAAAACTGCATCTAATAATACGAAAATTAAATTGATG
    AATGTTACATCAACATACTACGACAAAGTTGCTAAAGCTTTGAAATCCTATAACGATATT
    GAGAAAGATGTAAGTAAAAACAAAGGCGATAAGAATGTTCAATCGAAATTAAATCAAATT
    TCTAATGATATTCAAAGTGCTCACACTTCATACAAAGATGCTATCGATGGTTTATCACTT
    AGTGATGATGATAAAAAAACGTCTAAAAATATCGATAAATTAAACTCTGATTTGAATCAT
    GCATTTGATGATATTAAAAATGGCTATCAAAATAAAGATAAAAAACAACTTACAAAAGGA
    CAACAAGCGTTGTCAAAATTAAACTTAAATGCAAAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01627
  • symbol: SAOUHSC_01627
  • description: hypothetical protein
  • length: 193
  • theoretical pI: 9.8465
  • theoretical MW: 21472
  • GRAVY: -0.999482

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 14.2)
    Cellular processesCellular processesPathogenesistype III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.2)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 7.3)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.8)
    MetabolismEnergy metabolismPhotosynthesisphotosystem II protein PsbQ (TIGR03042; HMM-score: 5.1)
  • TheSEED:  
    FIG01108536: hypothetical protein 
  • PFAM:
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 16.3)
    no clan definedLzipper-MIP1; Leucine-zipper of ternary complex factor MIP1 (PF14389; HMM-score: 14.8)
    IncA; IncA protein (PF04156; HMM-score: 14.2)
    Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.9)
    DUF4763; Domain of unknown function (DUF4763) (PF15960; HMM-score: 13.4)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 13.2)
    HTH (CL0123) Mnd1; Mnd1 family (PF03962; HMM-score: 12.5)
    no clan definedDUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 12.3)
    TMCO5; TMCO5 family (PF14992; HMM-score: 11.8)
    YabB; Initiation control protein YabA (PF06156; HMM-score: 11.6)
    PRKG1_interact; cGMP-dependent protein kinase interacting domain (PF15898; HMM-score: 11.1)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 10.8)
    no clan definedDUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 10.7)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 9.8)
    Vps51 (CL0295) COG2; COG (conserved oligomeric Golgi) complex component, COG2 (PF06148; HMM-score: 9.1)
    no clan definedCnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 9.1)
    Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 8.1)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 7.9)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 7.6)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 7.4)
    FKBP (CL0487) Rotamase; PPIC-type PPIASE domain (PF00639; HMM-score: 7.4)
    no clan definedAx_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 7.2)
    GrpE; GrpE (PF01025; HMM-score: 6.5)
    Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LLAGCGS
  • SignalP: Signal peptide length 24 aa
    • Ymax: 0.337
    • Ymax_pos: 24
    • Cmax: 0.146
    • Cmax_pos: 24
    • Smax: 0.892
    • Smax_pos: 20
    • Smean: 0.757
    • D: 0.501
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLVSIVGATLLLAGCGSQNLAPLEEKTTDLREDNHQLKLDIQELNQQISDSKSKIKGLEKDKENSKKTASNNTKIKLMNVTSTYYDKVAKALKSYNDIEKDVSKNKGDKNVQSKLNQISNDIQSAHTSYKDAIDGLSLSDDDKKTSKNIDKLNSDLNHAFDDIKNGYQNKDKKQLTKGQQALSKLNLNAKS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]