From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1475 [new locus tag: NWMN_RS08310 ]
  • pan locus tag?: SAUPAN004155000
  • symbol: NWMN_1475
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1475 [new locus tag: NWMN_RS08310 ]
  • symbol: NWMN_1475
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1641970..1642668
  • length: 699
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAGTGTCGGTATTCTAATTTTTGTCATATCAGTGATCATTTCTATCATTACTACTATG
    CGCGAAAATAGTCATAAAGATAGACAAAATCAAAAGCCACCTCAAAAAACATCTACCGAT
    AATGAACCAAAAAAAGGTGGCTTTTTTGAAGAAATTGAGCGAACGTTTAAAGAAATAAGT
    GAAGAATTAAATGAAGAAGAAAAGAAATCATCGAAACGAAAATATGATGATACGTTACCA
    CCTTTATTCGATGAACTTCCAAAGGAAGAGCCTAAATCGAAACCTGTTGTAGAACCTATG
    GCACCTAAAAAACAACAAGAAACAAAACCGATGACAGAGAAACCAATCACAGTGCCTAAA
    GCAGAACCGGTGGAGCAGAAACATAGACCTTCTAGACAAGATAATTCTGACGAAATTAGA
    CGTCAATTAGAAAAATCACTTAGAGATGATATTAAAACGATTCGTACTGACATTGATAGA
    GAAAAAGAAAAGCAAATTGCTAAAATGGAAAAACGTGCTAGAGATATTATTGAGGATAAA
    TACTTATCTGAACGTACAAAACGTTTGAAATTAAAGCAGCTGCTTAATTCTCAAAATGTC
    GAAAAAGATTTGACTAAATCAGCGTTCCAATTTGATAAAGATGAAGTAATCAATGGTATG
    ATATGGTCAGAAATTTTAGCTAAACCAAAACAATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    699

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1475 [new locus tag: NWMN_RS08310 ]
  • symbol: NWMN_1475
  • description: hypothetical protein
  • length: 232
  • theoretical pI: 9.69683
  • theoretical MW: 27256
  • GRAVY: -1.13578

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesisputative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 17.2)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase, flavoprotein subunit (TIGR01816; HMM-score: 11)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 4.6)
  • TheSEED:  
    FIG01108188: hypothetical protein 
  • PFAM:
    no clan definedEphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 15.4)
    PulG; Type II secretory pathway pseudopilin (PF11773; HMM-score: 12.8)
    DUF2897; Protein of unknown function (DUF2897) (PF11446; HMM-score: 11.6)
    IncA; IncA protein (PF04156; HMM-score: 10.2)
    SICA_like (CL0474) SICA_alpha; SICA extracellular alpha domain (PF12887; HMM-score: 7.7)
    no clan definedNdc1_Nup; Nucleoporin protein Ndc1-Nup (PF09531; HMM-score: 5.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.5
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.434
    • Ymax_pos: 27
    • Cmax: 0.323
    • Cmax_pos: 27
    • Smax: 0.678
    • Smax_pos: 20
    • Smean: 0.508
    • D: 0.463
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEISEELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQQETKPMTEKPITVPKAEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDKYLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]