From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1826 [new locus tag: NWMN_RS10485 ]
  • pan locus tag?: SAUPAN004903000
  • symbol: map1
  • pan gene symbol?: map
  • synonym:
  • product: methionine aminopeptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1826 [new locus tag: NWMN_RS10485 ]
  • symbol: map1
  • product: methionine aminopeptidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2032184..2032942
  • length: 759
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTGTAAAAACAGAAGAAGAATTACAAGCGTTAAAAGAAATTGGATACATATGCGCT
    AAAGTGCGCAATACAATGCAAGCTGCAACCAAACCAGGTATCACTACGAAAGAGCTTGAT
    AATATTGCGAAAGAGTTATTTGAAGAATACGGTGCTATTTCTGCGCCAATTCATGATGAA
    AATTTTCCTGGTCAAACGTGTATTAGTGTCAATGAAGAGGTGGCACATGGGATTCCAAGT
    AAGCGTGTCATTCGTGAAGGAGATTTAGTAAATATTGATGTATCGGCTTTGAAGAATGGC
    TATTATGCAGATACAGGCATTTCATTTGTCGTTGGAGAATCAGATGATCCAATGAAACAA
    AAAGTATGTGACGTAGCAACGATGGCATTTGAGAATGCAATTGCAAAAGTAAAACCGGGT
    ACTAAGTTAAGTAACATTGGTAAAGCGGTGCATAATACAGCTAGACAAAATGATTTGAAA
    GTCATTAAAAACTTAACAGGTCATGGTGTTGGTTTATCATTACATGAAGCACCAGCACAT
    GTACTTAATTACTTTGATCCAAAAGACAAAACATTATTAACTGAAGGTATGGTATTAGCT
    ATTGAACCGTTTATCTCATCAAATGCATCATTTGTTACAGAAGGTAAAAATGAATGGGCT
    TTTGAAACGAGCGATAAAAGTTTTGTTGCTCAAATTGAGCATACGGTTATCGTGACTAAG
    GATGGTCCGATTTTAACGACAAAGATTGAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1826 [new locus tag: NWMN_RS10485 ]
  • symbol: Map1
  • description: methionine aminopeptidase
  • length: 252
  • theoretical pI: 4.93689
  • theoretical MW: 27502.1
  • GRAVY: -0.215476

Function[edit source | edit]

  • reaction:
    EC 3.4.11.18?  ExPASy
    Methionyl aminopeptidaseRelease of N-terminal amino acids, preferentially methionine, from peptides and arylamides
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairmethionine aminopeptidase, type I (TIGR00500; EC 3.4.11.18; HMM-score: 282.6)
    Genetic information processingProtein fateProtein modification and repairmethionine aminopeptidase, type II (TIGR00501; EC 3.4.11.18; HMM-score: 110.5)
    Unknown functionGeneralDNA-binding protein, 42 kDa (TIGR00495; HMM-score: 53.2)
    ectoine utilization protein EutD (TIGR02993; EC 3.-.-.-; HMM-score: 11.5)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisTranslation termination factors bacterial Methionine aminopeptidase (EC 3.4.11.18) 
    Protein degradationEC 3.4.11.- Aminopeptidases Methionine aminopeptidase (EC 3.4.11.18) 
    CBSS-312309.3.peg.1965 Methionine aminopeptidase (EC 3.4.11.18) 
  • PFAM:
    no clan definedPeptidase_M24; Metallopeptidase family M24 (PF00557; HMM-score: 168.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Co2+, Fe2+, Mn2+, Zn2+
  • effectors:
  • protein partners:
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_0509(fus)elongation factor G  [1] (data from MRSA252)
    NWMN_0741(gapA)glyceraldehyde 3-phosphate dehydrogenase 1  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_1151(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_2143(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    NWMN_1326(sucA)2-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.204
    • Ymax_pos: 29
    • Cmax: 0.287
    • Cmax_pos: 29
    • Smax: 0.359
    • Smax_pos: 28
    • Smean: 0.129
    • D: 0.175
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]