From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10485 [old locus tag: NWMN_1826 ]
  • pan locus tag?: SAUPAN004903000
  • symbol: NWMN_RS10485
  • pan gene symbol?: map
  • synonym:
  • product: methionine aminopeptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10485 [old locus tag: NWMN_1826 ]
  • symbol: NWMN_RS10485
  • product: methionine aminopeptidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2032184..2032942
  • length: 759
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2032184..2032942) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTGTAAAAACAGAAGAAGAATTACAAGCGTTAAAAGAAATTGGATACATATGCGCT
    AAAGTGCGCAATACAATGCAAGCTGCAACCAAACCAGGTATCACTACGAAAGAGCTTGAT
    AATATTGCGAAAGAGTTATTTGAAGAATACGGTGCTATTTCTGCGCCAATTCATGATGAA
    AATTTTCCTGGTCAAACGTGTATTAGTGTCAATGAAGAGGTGGCACATGGGATTCCAAGT
    AAGCGTGTCATTCGTGAAGGAGATTTAGTAAATATTGATGTATCGGCTTTGAAGAATGGC
    TATTATGCAGATACAGGCATTTCATTTGTCGTTGGAGAATCAGATGATCCAATGAAACAA
    AAAGTATGTGACGTAGCAACGATGGCATTTGAGAATGCAATTGCAAAAGTAAAACCGGGT
    ACTAAGTTAAGTAACATTGGTAAAGCGGTGCATAATACAGCTAGACAAAATGATTTGAAA
    GTCATTAAAAACTTAACAGGTCATGGTGTTGGTTTATCATTACATGAAGCACCAGCACAT
    GTACTTAATTACTTTGATCCAAAAGACAAAACATTATTAACTGAAGGTATGGTATTAGCT
    ATTGAACCGTTTATCTCATCAAATGCATCATTTGTTACAGAAGGTAAAAATGAATGGGCT
    TTTGAAACGAGCGATAAAAGTTTTGTTGCTCAAATTGAGCATACGGTTATCGTGACTAAG
    GATGGTCCGATTTTAACGACAAAGATTGAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10485 [old locus tag: NWMN_1826 ]
  • symbol: NWMN_RS10485
  • description: methionine aminopeptidase
  • length: 252
  • theoretical pI: 4.93689
  • theoretical MW: 27502.1
  • GRAVY: -0.215476

Function[edit source | edit]

  • reaction:
    EC 3.4.11.18?  ExPASy
    Methionyl aminopeptidaseRelease of N-terminal amino acids, preferentially methionine, from peptides and arylamides
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairmethionine aminopeptidase, type I (TIGR00500; EC 3.4.11.18; HMM-score: 282.6)
    Genetic information processingProtein fateProtein modification and repairmethionine aminopeptidase, type II (TIGR00501; EC 3.4.11.18; HMM-score: 110.5)
    Unknown functionGeneralDNA-binding protein, 42 kDa (TIGR00495; HMM-score: 53.2)
    ectoine utilization protein EutD (TIGR02993; EC 3.-.-.-; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    no clan definedPeptidase_M24; Metallopeptidase family M24 (PF00557; HMM-score: 168.1)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.204
    • Ymax_pos: 29
    • Cmax: 0.287
    • Cmax_pos: 29
    • Smax: 0.359
    • Smax_pos: 28
    • Smean: 0.129
    • D: 0.175
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446558796 NCBI
  • RefSeq: WP_000636142 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10485 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16

Relevant publications[edit source | edit]