From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1896 [new locus tag: NWMN_RS10910 ]
  • pan locus tag?: SAUPAN001371000
  • symbol: NWMN_1896
  • pan gene symbol?:
  • synonym:
  • product: phage major capsid protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1896 [new locus tag: NWMN_RS10910 ]
  • symbol: NWMN_1896
  • product: phage major capsid protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2109393..2110538
  • length: 1146
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGACTATAAATTTATCGGAAACATTCGCAAATGCGAAAAACGAATTTATTAATGCAGTA
    AACAACGGTGAACCGCAAGAAAGACAAAATGAATTGTACGGTGACATGATTAACCAACTA
    TTTGAAGAAACTAAATTACAAGCAAAAGCAGAAGCTGAAAGAGTTTCTAGTTTACCTAAA
    TCAGCACAATCTTTGAGTGCAAACCAAAGAAGTTTCTTCATGGATATCAATAAAAACGTT
    AACTATAAAGAAGAAAAACTTTTGCCAGAAGAAACAATTGATAGAATTTTTGAAGATTTG
    ACGACGAATCATCCGTTATTAGCTGATTTAGGTATTAAAAACGCTGGTTTGCGTTTGAAG
    TTCTTAAAATCTGAAACTTCTGGCGTAGCCGTTTGGGGTAAAATCTATGGTGAAATTAAA
    GGTCAATTAGATGCTGCGTTCAGTGAAGAAACAGCAATTCAAAATAAATTGACAGCGTTT
    GTTGTTTTACCAAAAGATTTAAATGATTTTGGTCCTGCGTGGATTGAAAGATTTGTTCGT
    GTTCAAATCGAAGAAGCATTTGCAGTGGCGCTTGAAACTGCGTTCTTAAAAGGTACTGGT
    AAAGACCAACCAATCGGCTTAAACCGTCAAGTACAAAAAGGTGTATCGGTAACTGAGGGT
    GCTTATCCAGAGAAAGAAGAACAAGGTACGCTTACATTTGCTAATCCGCGCGCTACGGTT
    AATGAATTGACGCAAGTGTTTAAATACCACTCAACTAACGAGAAAGGTAAATCAGTAGCG
    GTTAAAGGTAATGTAACAATGGTTGTTAATCCGTCCGATGCTTTTGAGGTTCAAGCACAG
    TATACACATTTAAATGCAAATGGCGTATATGTTACTGCTTTACCATTTAATTTGAATGTT
    ATCGAGTCTACAGTCCAAGAAGCAGGTAAGGTTTTAACGTACGTTAAAGGTTTATATGAT
    GGTTATTTAGCTGGTGGTATTAATGTTCAGAAATTTAAAGAAACACTTGCGTTAGATGAT
    ATGGATTTATACACTGCAAAACAATTTGCTTACGGCAAAGCGAAAGATAATAAAGTTGCT
    GCTGTTTGGAAATTAGATTTAAAAGGACATAAGCCAGCTTTAGAAGGTACCGAAGAAACA
    CTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1146

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1896 [new locus tag: NWMN_RS10910 ]
  • symbol: NWMN_1896
  • description: phage major capsid protein
  • length: 381
  • theoretical pI: 5.00056
  • theoretical MW: 42232.4
  • GRAVY: -0.366667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage major capsid protein, HK97 family (TIGR01554; HMM-score: 45.8)
  • TheSEED:  
    Phage major capsid protein 
  • PFAM:
    Phage-coat (CL0373) Phage_capsid; Phage capsid family (PF05065; HMM-score: 46.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.153
    • Ymax_pos: 13
    • Cmax: 0.139
    • Cmax_pos: 13
    • Smax: 0.22
    • Smax_pos: 48
    • Smean: 0.171
    • D: 0.16
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTINLSETFANAKNEFINAVNNGEPQERQNELYGDMINQLFEETKLQAKAEAERVSSLPKSAQSLSANQRSFFMDINKNVNYKEEKLLPEETIDRIFEDLTTNHPLLADLGIKNAGLRLKFLKSETSGVAVWGKIYGEIKGQLDAAFSEETAIQNKLTAFVVLPKDLNDFGPAWIERFVRVQIEEAFAVALETAFLKGTGKDQPIGLNRQVQKGVSVTEGAYPEKEEQGTLTFANPRATVNELTQVFKYHSTNEKGKSVAVKGNVTMVVNPSDAFEVQAQYTHLNANGVYVTALPFNLNVIESTVQEAGKVLTYVKGLYDGYLAGGINVQKFKETLALDDMDLYTAKQFAYGKAKDNKVAAVWKLDLKGHKPALEGTEETL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]