From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2038 [new locus tag: NWMN_RS11770 ]
  • pan locus tag?: SAUPAN005430000
  • symbol: luxS
  • pan gene symbol?: luxS
  • synonym:
  • product: S-ribosylhomocysteinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2038 [new locus tag: NWMN_RS11770 ]
  • symbol: luxS
  • product: S-ribosylhomocysteinase
  • replicon: chromosome
  • strand: +
  • coordinates: 2256281..2256751
  • length: 471
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGACAAAAATGAATGTTGAAAGTTTCAATTTAGATCATACTAAGGTGGTTGCCCCATTT
    ATTAGATTAGCGGGAACGATGGAAGGATTAAACGGAGATGTCATTCACAAATACGACATT
    CGTTTCAAACAACCAAACAAAGAACATATGGATATGCCCGGACTACATTCATTAGAACAT
    TTAATGGCTGAAAATATTAGAAATCATAGTGACAAAGTTGTTGATTTAAGTCCTATGGGT
    TGCCAAACTGGTTTCTATGTATCATTTATTAATCATGATAATTATGATGATGTATTAAAT
    ATTGTTGAAGCAACTTTAAATGATGTGCTAAATGCTACTGAAGTGCCTGCTTGTAATGAA
    GTACAATGTGGCTGGGCAGCAAGTCATTCATTAGAAGGTGCTAAAACTATCGCTCAAGCA
    TTTCTAGACAAACGAAACGAATGGCATGATGTTTTCGGTACAGGAAAATAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2038 [new locus tag: NWMN_RS11770 ]
  • symbol: LuxS
  • description: S-ribosylhomocysteinase
  • length: 156
  • theoretical pI: 5.45928
  • theoretical MW: 17513.7
  • GRAVY: -0.355128

Function[edit source | edit]

  • reaction:
    EC 4.4.1.21?  ExPASy
    S-ribosylhomocysteine lyaseS-(5-deoxy-D-ribos-5-yl)-L-homocysteine = L-homocysteine + (4S)-4,5-dihydroxypentan-2,3-dione
  • TIGRFAM:
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineMethionine Biosynthesis S-ribosylhomocysteine lyase (EC 4.4.1.21) 
    Lysine, threonine, methionine, and cysteineMethionine Degradation S-ribosylhomocysteine lyase (EC 4.4.1.21) 
    Methionine Biosynthesis Autoinducer-2 production protein LuxS 
  • PFAM:
    Peptidase_ME (CL0094) LuxS; S-Ribosylhomocysteinase (LuxS) (PF02664; HMM-score: 186.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Fe cation
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.146
    • Ymax_pos: 17
    • Cmax: 0.12
    • Cmax_pos: 33
    • Smax: 0.266
    • Smax_pos: 11
    • Smean: 0.208
    • D: 0.17
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEHLMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNEVQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • luxS no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: NWMN_1528 (CymR*)
    CymR* (TF) important in Cysteine metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]