From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005430000
  • symbol?: luxS
  • description?: S-ribosylhomocysteinase

      descriptions from strain specific annotations:

    • S-ribosylhomocysteinase
    • S-ribosylhomocysteine lyase / Autoinducer-2 production protein LuxS
    • S-Ribosylhomocysteinase (LuxS) family protein
    • autoinducer-2 production protein
    • autoinducer-2 production protein LuxS
    • S-ribosylhomocysteinase LuxS
  • strand?: +
  • coordinates?: 5589495..5589965
  • synteny block?: BlockID0042250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2126 (luxS)
    N315:
    SA1936 (luxS)
    NCTC8325:
    Newman:
    NWMN_2038 (luxS)
    USA300_FPR3757:
    04-02981:
    SA2981_2074 (luxS)
    08BA02176:
    C248_2149 (luxS)
    11819-97:
    MS7_2152 (luxS)
    71193:
    ST398NM01_2176
    ECT-R 2:
    ECTR2_1990
    ED133:
    SAOV_2175
    ED98:
    SAAV_2189 (luxS)
    HO 5096 0412:
    SAEMRSA15_20420 (luxS)
    JH1:
    SaurJH1_2208
    JH9:
    SaurJH9_2170
    JKD6008:
    SAA6008_02173 (luxS)
    JKD6159:
    SAA6159_02048 (luxS)
    LGA251:
    SARLGA251_19350 (luxS)
    M013:
    M013TW_2093
    MRSA252:
    SAR2222 (luxS)
    MSHR1132:
    SAMSHR1132_19570
    MSSA476:
    SAS2037
    Mu3:
    SAHV_2118 (luxS)
    Mu50:
    SAV2134 (luxS)
    MW2:
    MW2058 (luxS)
    RF122:
    SAB2018 (luxS)
    ST398:
    SAPIG2176 (luxS)
    T0131:
    SAT0131_02298 (tnpR)
    TCH60:
    HMPREF0772_11056 (luxS)
    TW20:
    SATW20_22720 (luxS)
    USA300_TCH1516:
    USA300HOU_2123 (luxS)
    VC40:
    SAVC_09545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
    N315            MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
    NCTC8325        MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
    Newman          MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
    USA300_FPR3757  MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
                    ************************************************************

    COL             LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
    N315            LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
    NCTC8325        LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
    Newman          LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
    USA300_FPR3757  LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
                    ************************************************************

    COL             VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
    N315            VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
    NCTC8325        VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
    Newman          VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
    USA300_FPR3757  VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
                    ************************************