From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
  • pan locus tag?: SAUPAN005498000
  • symbol: mtlA
  • pan gene symbol?: mtlA
  • synonym:
  • product: mannitol-specific IIA component

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
  • symbol: mtlA
  • product: mannitol-specific IIA component
  • replicon: chromosome
  • strand: +
  • coordinates: 2280913..2281347
  • length: 435
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGCGAATTATTTAGTAATGACAATATCTTTTTAAATGTAAATGTTAACAGCCAAAAT
    GAAGCAATTGAAAAAGCAGGTAAAGCCTTAGTTGATAGTGGTGCTGTAACAGATGCTTAT
    ATTCAAGCAATGAAAGATCGTGAGCAAGTCGTATCAACATTTATGGGAAATGGCTTAGCA
    ATTCCTCATGGCACAGATGAAGCTAAAACAAATGTGATTCACTCAGGTTTAACATTATTA
    CAAATCCCTGAAGGCGTTGACTGGGATGGCGAAGTAGTTAAAGTTGTCGTGGGAATTGCT
    GGTAAAGATGGCGAACATTTAGACTTGTTATCTAAAATTGCAATTACATTTAGCGAAGAA
    GAAAATGTGGATCGTATCGTTCAAGCAAAATCTGCAGAAGAAATTAAACAAGTATTCGAG
    GAGGCAGATGCATAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
  • symbol: MtlA
  • description: mannitol-specific IIA component
  • length: 144
  • theoretical pI: 4.0989
  • theoretical MW: 15542.3
  • GRAVY: -0.130556

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)
    Signal transductionSignal transductionPTSPTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)
    Signal transductionSignal transductionPTSPTS IIA-like nitrogen-regulatory protein PtsN (TIGR01419; HMM-score: 49.7)
  • TheSEED:  
    CarbohydratesSugar alcoholsMannitol Utilization PTS system, mannitol-specific IIA component 
  • PFAM:
    PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 125.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.196
    • Ymax_pos: 23
    • Cmax: 0.2
    • Cmax_pos: 23
    • Smax: 0.321
    • Smax_pos: 21
    • Smean: 0.155
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLAIPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVQAKSAEEIKQVFEEADA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] [2] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator: NWMN_2058 (MtlR*)
    MtlR* (TF) important in Mannitol utilizationRegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]