From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005498000
  • symbol?: mtlA
  • description?: PTS system mannitol specific transporter subunit IIA

      descriptions from strain specific annotations:

    • PTS system mannitol specific transporter subunit IIA
    • phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
    • phosphoenolpyruvate-dependent sugar phosphotransferase system EIIA 2
    • PTS system, mannitol specific IIA component
    • mannitol-specific phosphotransferase enzyme IIA component (PTS system mannitol-specific EIIA component) (EIIA-Mtl) (EIII-Mtl)
    • PTS system mannitol specific IIA component
    • PTS family fructose/mannitol (fru) porter component IIA
    • phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, MtlA_1
    • Mannitol-specific phosphotransferase enzyme IIA component
    • PTS family mannitol porter, IIA component
  • strand?: +
  • coordinates?: 5654851..5655295
  • synteny block?: BlockID0042800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1962 (mtlA)
    NCTC8325:
    Newman:
    NWMN_2059 (mtlA)
    USA300_FPR3757:
    04-02981:
    SA2981_2097 (mtlA)
    08BA02176:
    C248_2186 (mtlF)
    11819-97:
    MS7_2173 (mtlF)
    71193:
    ST398NM01_2213
    ECT-R 2:
    ECTR2_2011
    ED133:
    SAOV_2197
    ED98:
    SAAV_2212
    HO 5096 0412:
    SAEMRSA15_20640 (mtlF)
    JH1:
    SaurJH1_2228
    JH9:
    SaurJH9_2190
    JKD6008:
    SAA6008_02194 (mtlA_1)
    JKD6159:
    SAA6159_02067 (mtlA_1)
    LGA251:
    SARLGA251_19540 (mtlF)
    M013:
    M013TW_2116
    MRSA252:
    SAR2246 (mtlF)
    MSHR1132:
    SAMSHR1132_19900
    MSSA476:
    SAS2059
    Mu3:
    SAHV_2142 (mtlA)
    Mu50:
    SAV2158 (mtlA)
    MW2:
    MW2084 (mtlA)
    RF122:
    SAB2038 (mtlF)
    ST398:
    SAPIG2213
    T0131:
    SAT0131_02321
    TCH60:
    HMPREF0772_11035 (mtlF)
    TW20:
    SATW20_22930 (mtlF)
    USA300_TCH1516:
    USA300HOU_2148 (mtlA)
    VC40:
    SAVC_09655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLA
    N315            MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLA
    NCTC8325        MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLA
    Newman          MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLA
    USA300_FPR3757  MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMENGLA
                    ******************************************************* ****

    COL             IPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEE
    N315            IPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEE
    NCTC8325        IPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEE
    Newman          IPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEE
    USA300_FPR3757  IPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEE
                    ************************************************************

    COL             ENVDRIVQAKSAEEIKQVFEEADA
    N315            ENVDRIVQAKSAEEIKQVFEEADA
    NCTC8325        ENVDRIVQAKSAEEIKQVFEEADA
    Newman          ENVDRIVQAKSAEEIKQVFEEADA
    USA300_FPR3757  ENVDRIVQAKSAEEIKQVFEEADA
                    ************************