From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003304000
  • symbol?: ptsI
  • description?: phosphoenolpyruvate-protein phosphotransferase

      descriptions from strain specific annotations:

    • phosphoenolpyruvate-protein phosphotransferase
    • phosphoenolpyruvate-protein phosphatase
    • Phosphoenolpyruvate-protein phosphotransferase of PTS system
    • Phosphoenolpyruvate phosphotransferase
    • phosphoenolpyruvate-protein phosphotransferase (Phosphotransferase system, enzyme I)
    • PTS family phosphoenolpyruvate (PEP) porter component I
  • strand?: +
  • coordinates?: 3674011..3675732
  • synteny block?: BlockID0023880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1092 (ptsI)
    N315:
    SA0935 (ptsI)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1040 (ptsI)
    08BA02176:
    C248_1110 (ptsI)
    11819-97:
    MS7_1041 (ptsI)
    71193:
    ST398NM01_1081
    ECT-R 2:
    ECTR2_939 (ptsP)
    ED133:
    SAOV_1028
    ED98:
    SAAV_1049 (ptsI)
    HO 5096 0412:
    SAEMRSA15_09140 (ptsI)
    JH1:
    SaurJH1_1166
    JH9:
    SaurJH9_1144
    JKD6008:
    SAA6008_01039 (ptsA)
    JKD6159:
    SAA6159_00940 (ptsA)
    LGA251:
    SARLGA251_09970 (ptsI)
    M013:
    M013TW_1016
    MRSA252:
    SAR1057 (ptsI)
    MSHR1132:
    SAMSHR1132_09310
    MSSA476:
    SAS1019
    Mu3:
    SAHV_1076 (ptsI)
    Mu50:
    SAV1084 (ptsI)
    MW2:
    MW0966 (ptsI)
    RF122:
    SAB0950 (ptsI)
    ST398:
    SAPIG1081 (ptsP)
    T0131:
    SAT0131_01120
    TCH60:
    HMPREF0772_12149 (ptsP)
    TW20:
    SATW20_10790 (ptsI)
    USA300_TCH1516:
    USA300HOU_1026 (ptsI)
    VC40:
    SAVC_04580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKLIKGIAASDGVAIAKAYLLVEPDLTFDKNEKVTDVEGEVAKFNSAIEASKVELTKIR
    N315            MSKLIKGIAASDGVAIAKAYLLVEPDLTFDKNEKVTDVEGEVAKFNSAIEASKVELTKIR
    NCTC8325        MSKLIKGIAASDGVAIAKAYLLVEPDLTFDKNEKVTDVEGEVAKFNSAIEASKVELTKIR
    Newman          MSKLIKGIAASDGVAIAKAYLLVEPDLTFDKNEKVTDVEGEVAKFNSAIEASKVELTKIR
    USA300_FPR3757  MSKLIKGIAASDGVAIAKAYLLVEPDLTFDKNEKVTDVEGEVAKFNSAIEASKVELTKIR
                    ************************************************************

    COL             NNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM
    N315            NNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM
    NCTC8325        NNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM
    Newman          NNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM
    USA300_FPR3757  NNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM
                    ************************************************************

    COL             DNEYMKERAADIRDVSKRVLSHILGVELPNPSMIDESVVIVGNDLTPSDTAQLNKEFVQG
    N315            DNEYMKERAADIRDVSKRVLSHILGVELPNPSMIDESVVIVGNDLTPSDTAQLNKEFVQG
    NCTC8325        DNEYMKERAADIRDVSKRVLSHILGVELPNPSMIDESVVIVGNDLTPSDTAQLNKEFVQG
    Newman          DNEYMKERAADIRDVSKRVLSHILGVELPNPSMIDESVVIVGNDLTPSDTAQLNKEFVQG
    USA300_FPR3757  DNEYMKERAADIRDVSKRVLSHILGVELPNPSMIDESVVIVGNDLTPSDTAQLNKEFVQG
                    ************************************************************

    COL             FATNIGGRTSHSAIMSRSLEIPAIVGTKSITQEVKQGDMIIVDGLNGDVIVNPTEDELIA
    N315            FATNIGGRTSHSAIMSRSLEIPAIVGTKSITQEVKQGDMIIVDGLNGDVIVNPTEDELIA
    NCTC8325        FATNIGGRTSHSAIMSRSLEIPAIVGTKSITQEVKQGDMIIVDGLNGDVIVNPTEDELIA
    Newman          FATNIGGRTSHSAIMSRSLEIPAIVGTKSITQEVKQGDMIIVDGLNGDVIVNPTEDELIA
    USA300_FPR3757  FATNIGGRTSHSAIMSRSLEIPAIVGTKSITQEVKQGDMIIVDGLNGDVIVNPTEDELIA
                    ************************************************************

    COL             YQDKRERYFADKKELQKLRDADTVTVDGVHAELAANIGTPNDLPGVIENGAQGIGLYRTE
    N315            YQDKRECYFADKKELQKLRDADTVTVDGVHAELAANIGTPNDLPGVIENGAQGIGLYRTE
    NCTC8325        YQDKRERYFADKKELQKLRDADTVTVDGVHAELAANIGTPNDLPGVIENGAQGIGLYRTE
    Newman          YQDKRERYFADKKELQKLRDADTVTVDGVHAELAANIGTPNDLPGVIENGAQGIGLYRTE
    USA300_FPR3757  YQDKRERYFADKKELQKLRDADTVTVDGVHAELAANIGTPNDLPGVIENGAQGIGLYRTE
                    ****** *****************************************************

    COL             FLYMGRDQMPTEEEQFEAYKEVLEAMGGKRVVVRTLDIGGDKELSYLNLPEEMNPFLGYR
    N315            FLYMGRDQMPTEEEQFEAYKEVLEAMDGKRVVVRTLDIGGDKELSYLNLPEEMNPFLGYR
    NCTC8325        FLYMGRDQMPTEEEQFEAYKEVLEAMGGKRVVVRTLDIGGDKELSYLNLPEEMNPFLGYR
    Newman          FLYMGRDQMPTEEEQFEAYKEVLEAMGGKRVVVRTLDIGGDKELSYLNLPEEMNPFLGYR
    USA300_FPR3757  FLYMGRDQMPTEEEQFEAYKEVLEAMGGKRVVVRTLDIGGDKELSYLNLPEEMNPFLGYR
                    **************************.*********************************

    COL             AIRLCLAQQDIFRPQLRALLRASVYGKLNIMFPMVATINEFREAKAILLEEKENLKNEGH
    N315            AIRLCLAQQDIFRPQLRALLRASVYGKLNIMFPMVATINEFREAKAILLEEKENLKNEGH
    NCTC8325        AIRLCLAQQDIFRPQLRALLRASVYGKLNIMFPMVATINEFREAKAILLEEKENLKNEGH
    Newman          AIRLCLAQQDIFRPQLRALLRASVYGKLNIMFPMVATINEFREAKAILLEEKENLKNEGH
    USA300_FPR3757  AIRLCLAQQDIFRPQLRALLRASVYGKLNIMFPMVATINEFREAKAILLEEKENLKNEGH
                    ************************************************************

    COL             DISDDIELGIMVEIPATAALADVFAKEVDFFSIGTNDLIQYTLAADRMSERVSYLYQPYN
    N315            DISDDIELGIMVEIPATAALADVFAKEVDFFSIGTNDLIQYTLAADRMSERVSYLYQPYN
    NCTC8325        DISDDIELGIMVEIPATAALADVFAKEVDFFSIGTNDLIQYTLAADRMSERVSYLYQPYN
    Newman          DISDDIELGIMVEIPATAALADVFAKEVDFFSIGTNDLIQYTLAADRMSERVSYLYQPYN
    USA300_FPR3757  DISDDIELGIMVEIPATAALADVFAKEVDFFSIGTNDLIQYTLAADRMSERVSYLYQPYN
                    ************************************************************

    COL             PSILRLVKQVIEASHKEGKWTGMCGEMAGDETAIPLLLGLGLDEFSMSATSILKARRQIN
    N315            PSILRLVKQVIEASHKEGKWTGMCGEMAGDETAIPLLLGLGLDEFSMSATSILKARRQIN
    NCTC8325        PSILRLVKQVIEASHKEGKWTGMCGEMAGDETAIPLLLGLGLDEFSMSATSILKARRQIN
    Newman          PSILRLVKQVIEASHKEGKWTGMCGEMAGDETAIPLLLGLGLDEFSMSATSILKARRQIN
    USA300_FPR3757  PSILRLVKQVIEASHKEGKWTGMCGEMAGDETAIPLLLGLGLDEFSMSATSILKARRQIN
                    ************************************************************

    COL             GLSKNEMTELANRAVDCATQEEVIELVNNYVK
    N315            GLSKNEMTELANRAVDCATQEEVIELVNNYVK
    NCTC8325        GLSKNEMTELANRAVDCATQEEVIELVNNYVK
    Newman          GLSKNEMTELANRAVDCATQEEVIELVNNYVK
    USA300_FPR3757  GLSKNEMTELANRAVDCATQEEVIELVNNYVK
                    ********************************