From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005495000
  • symbol?: mtlF
  • description?: PTS mannitol transporter subunit IICB

      descriptions from strain specific annotations:

    • PTS mannitol transporter subunit IICB
    • PTS system, mannitol specific IIBC component
    • PTS system, mannitol-specific IIBC components
    • PTS system mannitol specific transporter subunit IIBC
    • PTS system mannitol-specific protein
    • PTS system mannitol specific IIBC component
    • mannitol specific IIBC component of PTS system
    • Mannitol-specific phosphotransferase enzyme IIB component
    • PTS family fructose/mannitol (fru) porter component IIBC
    • PTS family mannitol porter, EIICB component
    • PTS system, mannitol-specific IIB component / PTS system, mannitol-specific IIC component
    • pts system mannitol-specific eiicba component (eiicba-mtl) (eii-mtl)
    • PTS system mannitol-specific EIICB component
    • PTS system mannitol-specific transporter subunit IIC
  • strand?: +
  • coordinates?: 5651125..5652675
  • synteny block?: BlockID0042770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1960 (mtlF)
    NCTC8325:
    Newman:
    NWMN_2057 (mtlF)
    USA300_FPR3757:
    04-02981:
    SA2981_2095 (mtlF)
    08BA02176:
    C248_2184 (mtlA)
    11819-97:
    MS7_2171 (mtlA)
    71193:
    ST398NM01_2210
    ECT-R 2:
    ECTR2_2009 (mtlA)
    ED133:
    SAOV_2195
    ED98:
    SAAV_2210
    HO 5096 0412:
    SAEMRSA15_20620 (mtlA)
    JH1:
    SaurJH1_2226
    JH9:
    SaurJH9_2188
    JKD6008:
    SAA6008_02192 (mtlA)
    JKD6159:
    SAA6159_02065 (mtlA)
    LGA251:
    SARLGA251_19520 (mtlA)
    M013:
    M013TW_2114
    MRSA252:
    SAR2244 (mtlA)
    MSHR1132:
    SAMSHR1132_19880
    MSSA476:
    SAS2057
    Mu3:
    SAHV_2140 (mtlF)
    Mu50:
    SAV2156 (mtlF)
    MW2:
    MW2082 (mtlF)
    RF122:
    SAB2036 (mtlA)
    ST398:
    SAPIG2210
    T0131:
    SAT0131_02319
    TCH60:
    HMPREF0772_11037 (mtlA)
    TW20:
    SATW20_22910 (mtlA)
    USA300_TCH1516:
    USA300HOU_2146 (mtlF)
    VC40:
    SAVC_09645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQTEEKKGIGRRVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWLPNKDLATLAGPM
    N315            MSQTEEKKGIGRRVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWLPNKDLATLAGPM
    NCTC8325        MSQTEEKKGIGRRVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWLPNKDLATLAGPM
    Newman          MSQTEEKKGIGRRVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWLPNKDLATLAGPM
    USA300_FPR3757  MSQTEEKKGIGRRVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWLPNKDLATLAGPM
                    ************************************************************

    COL             ITYLIPLLIAFSGGRLIYDLRGGIIAATATMGVIVALPDTPMLLGAMIMGPLVGWLMKKT
    N315            ITYLIPLLIAFSGGRLIYDLRGGIIAATATMGVIVALPDTPMLLGAMIMGPLVGWLMKKT
    NCTC8325        ITYLIPLLIAFSGGRLIYDLRGGIIAATATMGVIVALPDTPMLLGAMIMGPLVGWLMKKT
    Newman          ITYLIPLLIAFSGGRLIYDLRGGIIAATATMGVIVALPDTPMLLGAMIMGPLVGWLMKKT
    USA300_FPR3757  ITYLIPLLIAFSGGRLIYDLRGGIIAATATMGVIVALPDTPMLLGAMIMGPLVGWLMKKT
                    ************************************************************

    COL             DQLIQPRTPQGFEMLFNNFSAGILGFIMTIAGFKILAPLMKFIMHILSVAVEALVHAHLL
    N315            DQLIQPRTPQGFEMLFNNFSAGILGFIMTIAGFKILAPLMKFIMHILSVAVEALVHAHLL
    NCTC8325        DQLIQPRTPQGFEMLFNNFSAGILGFIMTIAGFKILAPLMKFIMHILSVAVEALVHAHLL
    Newman          DQLIQPRTPQGFEMLFNNFSAGILGFIMTIAGFKILAPLMKFIMHILSVAVEALVHAHLL
    USA300_FPR3757  DQLIQPRTPQGFEMLFNNFSAGILGFIMTIAGFKILAPLMKFIMHILSVAVEALVHAHLL
                    ************************************************************

    COL             PLVSILVEPAKIVFLNNAINHGVFTPLGADQAAKAGQSILYTIESNPGPGLGILLAYMIF
    N315            PLVSILVEPAKIVFLNNAINHGVFTPLGADQAAKAGQSILYTIESNPGPGLGILLAYMIF
    NCTC8325        PLVSILVEPAKIVFLNNAINHGVFTPLGADQAAKAGQSILYTIESNPGPGLGILLAYMIF
    Newman          PLVSILVEPAKIVFLNNAINHGVFTPLGADQAAKAGQSILYTIESNPGPGLGILLAYMIF
    USA300_FPR3757  PLVSILVEPAKIVFLNNAINHGVFTPLGADQAAKAGQSILYTIESNPGPGLGILLAYMIF
                    ************************************************************

    COL             GKGTAKTTSYGAGIIHFLGGIHEIYFPYVLMRPLLFIAVILGGMTGVATYQATGFGFKSP
    N315            GKGTAKATSYGAGIIHFLGGIHEIYFPYVLMRPLLFIAVILGGMTGVATYQATGFGFKSP
    NCTC8325        GKGTAKATSYGAGIIHFLGGIHEIYFPYVLMRPLLFIAVILGGMTGVATYQATGFGFKSP
    Newman          GKGTAKATSYGAGIIHFLGGIHEIYFPYVLMRPLLFIAVILGGMTGVATYQATGFGFKSP
    USA300_FPR3757  GKGTAKATSYGAGIIHFLGGIHEIYFPYVLMRPLLFIAVILGGMTGVATYQATGFGFKSP
                    ******:*****************************************************

    COL             ASPGSFIVYCLNAPRGEFLHMLLGVFLAALVSFVVAALIMKFTREPKQDLEAATAQMENT
    N315            ASPGSFIVYCLNAPRGEFLHMLLGVFLAALVSFVVAALIMKFTREPKQDLEAATAQMENT
    NCTC8325        ASPGSFIVYCLNAPRGEFLHMLLGVFLAALVSFVVAALIMKFTREPKQDLEAATAQMENT
    Newman          ASPGSFIVYCLNAPRGEFLHMLLGVFLAALVSFVVAALIMKFTREPKQDLEAATAQMENT
    USA300_FPR3757  ASPGSFIVYCLNAPRGEFLHMLLGVFLAALVSFVVAALIMKFTREPKQDLEAATAQMENT
                    ************************************************************

    COL             KGKKSSVASKLVSSDKNVNTEENASGNVSETSSSDDDPEALLDNYNTEDVDAHNYNNINH
    N315            KGKKSSVASKLVSSDKNVNTEENASGNVSETSSSDDDPEALLDNYNTEDVDAHNYNNINH
    NCTC8325        KGKKSSVASKLVSSDKNVNTEENASGNVSETSSSDDDPEALLDNYNTEDVDAHNYNNINH
    Newman          KGKKSSVASKLVSSDKNVNTEENASGNVSETSSSDDDPEALLDNYNTEDVDAHNYNNINH
    USA300_FPR3757  KGKKSSVASKLVSSDKNVNTEENASGNVSETSSSDDDPEALLDNYNTEDVDAHNYNNINH
                    ************************************************************

    COL             VIFACDAGMGSSAMGASMLRNKFKKAGINDITVTNTAINQLPKDAQLVITQKKLTDRAIK
    N315            VIFACDAGMGSSAMGASMLRNKFKKAGINDITVTNTAINQLPKDAQLVITQKKLTDRAIK
    NCTC8325        VIFACDAGMGSSAMGASMLRNKFKKAGINDITVTNTAINQLPKDAQLVITQKKLTDRAIK
    Newman          VIFACDAGMGSSAMGASMLRNKFKKAGINDITVTNTAINQLPKDAQLVITQKKLTDRAIK
    USA300_FPR3757  VIFACDAGMGSSAMGASMLRNKFKKAGINDITVTNTAINQLPKDAQLVITQKKLTDRAIK
                    ************************************************************

    COL             QTPNAIHISVDNFLNSPRYEELLNNLKKDDQA
    N315            QTPNAIHISVDNFLNSPRYEELLNNLKKDDQA
    NCTC8325        QTPNAIHISVDNFLNSPRYEELLNNLKKDDQA
    Newman          QTPNAIHISVDNFLNSPRYEELLNNLKKDDQA
    USA300_FPR3757  QTPNAIHISVDNFLNSPRYEELLNNLKKDDQA
                    ********************************