From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2426 [new locus tag: NWMN_RS13945 ]
  • pan locus tag?: SAUPAN006178000
  • symbol: srtA
  • pan gene symbol?: srtA
  • synonym:
  • product: sortase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2426 [new locus tag: NWMN_RS13945 ]
  • symbol: srtA
  • product: sortase
  • replicon: chromosome
  • strand: -
  • coordinates: 2669355..2669975
  • length: 621
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAATGGACAAATCGATTAATGACAATCGCTGGTGTGGTACTTATCCTAGTGGCA
    GCATATTTGTTTGCTAAACCACATATCGATAATTATCTTCACGATAAAGATAAAGATGAA
    AAGATTGAACAATATGATAAAAATGTAAAAGAACAGGCGAGTAAAGATAAAAAGCAGCAA
    GCTAAACCTCAAATTCCGAAAGATAAATCGAAAGTGGCAGGCTATATTGAAATTCCAGAT
    GCTGATATTAAAGAACCAGTATATCCAGGACCAGCAACACCTGAACAATTAAATAGAGGT
    GTAAGCTTTGCAGAAGAAAATGAATCACTAGATGATCAAAATATTTCAATTGCAGGACAC
    ACTTTCATTGACCGTCCGAACTATCAATTTACAAATCTTAAAGCAGCCAAAAAAGGTAGT
    ATGGTGTACTTTAAAGTTGGTAATGAAACACGTAAGTATAAAATGACAAGTATAAGAGAT
    GTTAAGCCTACAGATGTAGGAGTTCTAGATGAACAAAAAGGTAAAGATAAACAATTAACA
    TTAATTACTTGTGATGATTACAATGAAAAGACAGGCGTTTGGGAAAAACGTAAAATCTTT
    GTAGCTACAGAAGTCAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    621

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2426 [new locus tag: NWMN_RS13945 ]
  • symbol: SrtA
  • description: sortase
  • length: 206
  • theoretical pI: 9.32932
  • theoretical MW: 23540.7
  • GRAVY: -0.792233

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOthersortase (TIGR01076; EC 3.4.22.-; HMM-score: 163.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsortase (TIGR01076; EC 3.4.22.-; HMM-score: 163.4)
    sortase, marine proteobacterial type (TIGR03784; HMM-score: 34.8)
    Cell structureCell envelopeOthersortase, SrtB family (TIGR03064; EC 3.4.22.71; HMM-score: 30.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsortase, SrtB family (TIGR03064; EC 3.4.22.71; HMM-score: 30.9)
  • TheSEED:  
    Cell Wall and CapsuleGram-Positive cell wall componentsSortase LPXTG specific sortase A 
    Iron acquisition and metabolismIron acquisition and metabolism - no subcategoryHeme, hemin uptake and utilization systems in GramPositives LPXTG specific sortase A 
  • PFAM:
    no clan definedSortase; Sortase family (PF04203; HMM-score: 74.6)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 16.7)
    DUF3959; Protein of unknown function (DUF3959) (PF13105; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.299
    • Ymax_pos: 26
    • Cmax: 0.174
    • Cmax_pos: 26
    • Smax: 0.651
    • Smax_pos: 23
    • Smean: 0.545
    • D: 0.394
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • srtA no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]