From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00120 [old locus tag: NWMN_0021 ]
  • pan locus tag?: SAUPAN000036000
  • symbol: NWMN_RS00120
  • pan gene symbol?: walJ
  • synonym:
  • product: MBL fold metallo-hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS00120 [old locus tag: NWMN_0021 ]
  • symbol: NWMN_RS00120
  • product: MBL fold metallo-hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 29978..30778
  • length: 801
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (29978..30778) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTT
    GTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAA
    GAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCAT
    GAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATT
    TATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGAT
    CAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCG
    TTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAG
    AAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGT
    GGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGT
    TATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGAT
    GCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCAT
    TTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAAC
    GAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCA
    ACGCCAATATATACAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    801

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS00120 [old locus tag: NWMN_0021 ]
  • symbol: NWMN_RS00120
  • description: MBL fold metallo-hydrolase
  • length: 266
  • theoretical pI: 6.34904
  • theoretical MW: 30327.4
  • GRAVY: -0.397368

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolase (TIGR03413; EC 3.1.2.6; HMM-score: 33.5)
    Genetic information processingTranscriptionRNA processingribonuclease Z (TIGR02651; EC 3.1.26.11; HMM-score: 31.9)
    phosphonate metabolism protein PhnP (TIGR03307; HMM-score: 26.9)
    arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein (TIGR03675; HMM-score: 25.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme PQQ biosynthesis protein B (TIGR02108; HMM-score: 23.5)
    Genetic information processingTranscriptionDegradation of RNAbeta-CASP ribonuclease, RNase J family (TIGR00649; EC 3.1.-.-; HMM-score: 23.3)
    Unknown functionEnzymes of unknown specificityquinoprotein relay system zinc metallohydrolase 1 (TIGR04558; HMM-score: 23.1)
    Unknown functionEnzymes of unknown specificityquinoprotein relay system zinc metallohydrolase 2 (TIGR04559; EC 3.-.-.-; HMM-score: 15.8)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 12.7)
    Cellular processesCellular processesDNA transformationDNA internalization-related competence protein ComEC/Rec2 (TIGR00361; HMM-score: 11.6)
  • TheSEED:
  • PFAM:
    Metallo-HOrase (CL0381) Lactamase_B; Metallo-beta-lactamase superfamily (PF00753; HMM-score: 81.1)
    Lactamase_B_2; Beta-lactamase superfamily domain (PF12706; HMM-score: 73.6)
    Lactamase_B_6; Metallo-beta-lactamase superfamily domain (PF16661; HMM-score: 23.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.244
    • Ymax_pos: 11
    • Cmax: 0.151
    • Cmax_pos: 24
    • Smax: 0.74
    • Smax_pos: 1
    • Smean: 0.558
    • D: 0.366
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446010793 NCBI
  • RefSeq: WP_000088648 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS00120 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]