From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01040 [old locus tag: NWMN_0185 ]
  • pan locus tag?: SAUPAN001123000
  • symbol: NWMN_RS01040
  • pan gene symbol?: tarI'
  • synonym:
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01040 [old locus tag: NWMN_0185 ]
  • symbol: NWMN_RS01040
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 239903..240619
  • length: 717
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (239903..240619) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATTTATGCAGGTATTTTAGCAGGAGGTATTGGTTCGAGAATGGGGAACGTGCCATTA
    CCAAAACAATTTTTAGATATTGATAATAAACCGATTTTAATCCATACAATTGAGAAGTTC
    ATTTTAGTGAGTGAATTTAATGAGATTATTATCGCAACGCCAGCACAGTGGATTTCCCAT
    ACACAGGATATTTTAAAAAAATATAACATTACAGATCAACGTGTCAAAGTAGTTGCAGGT
    GGTACGGATCGAAATGAAACAATTATGAACATTATCGACCATATTCGCAATGTAAATGGA
    ATTAATAATGATGATGTGATTGTAACTCATGATGCCGTAAGACCATTTTTAACTCAACGT
    ATTATTAAAGAGAACATTGAAGTAGCAGCAAAATATGGTGCAGTAGATACAGTCATTGAA
    GCAATTGATACGATTGTAATGTCTAAAGATAAACAGAACATACACAGTATCCCTGTAAGG
    AATGAAATGTATCAAGGCCAAACACCACAATCATTTAATATTAAATTATTACAAGATAGT
    TATCGCGCCTTAAGTAGTGAACAAAAAGAAATCTTATCAGATGCATGTAAAATCATTGTC
    GAATCTGGACATGCAGTTAAATTGGTACGTGGAGAACTATACAACATTAAAGTGACAACA
    CCGTATGATTTAAAAGTAGCAAATGCCATTATTCAAGGTGATATTGCCGATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01040 [old locus tag: NWMN_0185 ]
  • symbol: NWMN_RS01040
  • description: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • length: 238
  • theoretical pI: 5.95177
  • theoretical MW: 26574.4
  • GRAVY: -0.0890756

Function[edit source | edit]

  • reaction:
    EC 2.7.7.60?  ExPASy
    2-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseCTP + 2-C-methyl-D-erythritol 4-phosphate = diphosphate + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TIGR00453; EC 2.7.7.60; HMM-score: 159.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate cytidylyltransferase (TIGR00466; EC 2.7.7.38; HMM-score: 21.1)
    molybdenum cofactor cytidylyltransferase (TIGR03310; EC 2.7.7.76; HMM-score: 21.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor guanylyltransferase (TIGR02665; EC 2.7.7.77; HMM-score: 19.1)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 17)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesglucose-1-phosphate cytidylyltransferase (TIGR02623; EC 2.7.7.33; HMM-score: 16.6)
    pseudaminic acid cytidylyltransferase (TIGR03584; EC 2.7.7.81; HMM-score: 13.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesglucose-1-phosphate thymidylyltransferase (TIGR01207; EC 2.7.7.24; HMM-score: 12.6)
  • TheSEED:
  • PFAM:
    GT-A (CL0110) IspD; 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (PF01128; HMM-score: 148)
    NTP_transf_3; MobA-like NTP transferase domain (PF12804; HMM-score: 36.1)
    CTP_transf_3; Cytidylyltransferase (PF02348; HMM-score: 20.3)
    NTP_transferase; Nucleotidyl transferase (PF00483; HMM-score: 17.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 25
    • Cmax: 0.159
    • Cmax_pos: 58
    • Smax: 0.144
    • Smax_pos: 19
    • Smean: 0.115
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446561129 NCBI
  • RefSeq: WP_000638475 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIYAGILAGGIGSRMGNVPLPKQFLDIDNKPILIHTIEKFILVSEFNEIIIATPAQWISHTQDILKKYNITDQRVKVVAGGTDRNETIMNIIDHIRNVNGINNDDVIVTHDAVRPFLTQRIIKENIEVAAKYGAVDTVIEAIDTIVMSKDKQNIHSIPVRNEMYQGQTPQSFNIKLLQDSYRALSSEQKEILSDACKIIVESGHAVKLVRGELYNIKVTTPYDLKVANAIIQGDIADD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01040 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]