From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01145 [old locus tag: NWMN_0204 ]
  • pan locus tag?: SAUPAN001156000
  • symbol: NWMN_RS01145
  • pan gene symbol?: rbsU
  • synonym:
  • product: ribose transporter RbsU

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01145 [old locus tag: NWMN_0204 ]
  • symbol: NWMN_RS01145
  • product: ribose transporter RbsU
  • replicon: chromosome
  • strand: -
  • coordinates: 261246..262127
  • length: 882
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (261246..262127) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAGCATTGTTGCATTACTTATCGGGTTAGGCCCCTTAATTGGCTGGGGCTTCTTCCCA
    ACAGTCGCTTCAAAGTTTGGTGGTAAACCTGTACATCAAATTATCGGTGCTACTGTAGGT
    ACGTTAATCTTCGCTATTATATTAGCCGTAGTCACATCAAGTGGCTTCCCTACTGGAACC
    AATTTGCTATTCGCCTTATTATCAGGTGCAGGATGGGGATTCGGACAAATCATTACATTT
    AAAGCGTTCGAATTAGTCGGCTCATCTCGTGCCATGCCAGTCACAACAGCATTCCAATTA
    TTAGGCGCATCTTTATGGGGTGTCTTTGCATTAGGAAATTGGCCAGGCATTGGTCATAAA
    ATCATTGGATTTACAGCTTTAGTCGTTATTCTAATTGGAGCGCGTATGACAGTTTGGAGT
    GAACGCAAAGAAGCAAGTAACGCCAAAAATTTACGTCGTGCAGTGGTACTTCTGTTAATT
    GGTGAATTTGGATACTGGTTATATTCAGCTGCACCGCAAGCAACTTCTATTGATGGCCTA
    ACTGCCTTTTTACCTCAAGCAATGGGTATGGTAATTGTTGCAGTCATTTATGGCTTTATG
    AATATGAAAGCAGAGAATCCATTCCGTAATAAAATTACGTGGTTACAAATTATTTCAGGT
    TTCTTCTTTGCATTTGGTGCTTTAACATATCTTATTTCAGCACAACCTAATATGAATGGT
    TTAGCAACTGGATTTATTCTTTCTCAAACATCCGTTGTGCTTGCTACATTAACTGGTATT
    TATTTCTTAAAACAACATAAAACGTCAAAAGAAATGGTTATTACAATCATCGGCTTAGTA
    CTCATTTTAGTAGCCGCTTCTGTTACAGTATTTATAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    882

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01145 [old locus tag: NWMN_0204 ]
  • symbol: NWMN_RS01145
  • description: ribose transporter RbsU
  • length: 293
  • theoretical pI: 10.7683
  • theoretical MW: 31243.1
  • GRAVY: 0.898976

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsRhaT L-rhamnose-proton symporter family protein (TIGR00776; HMM-score: 258.3)
  • TheSEED:
  • PFAM:
    DMT (CL0184) Sugar_transport; Sugar transport protein (PF06800; HMM-score: 364.2)
    TMEM144; Transmembrane family, TMEM144 of transporters (PF07857; HMM-score: 16.2)
    no clan definedHIG_1_N; Hypoxia induced protein conserved region (PF04588; HMM-score: 9.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 10
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.23
    • Ymax_pos: 26
    • Cmax: 0.222
    • Cmax_pos: 26
    • Smax: 0.362
    • Smax_pos: 15
    • Smean: 0.24
    • D: 0.234
  • predicted transmembrane helices (TMHMM): 10

Accession numbers[edit source | edit]

  • GI: 445951349 NCBI
  • RefSeq: WP_000029204 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01145 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]