From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01365 [old locus tag: NWMN_0247 ]
  • pan locus tag?: SAUPAN001223000
  • symbol: NWMN_RS01365
  • pan gene symbol?:
  • synonym:
  • product: formate/nitrite transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01365 [old locus tag: NWMN_0247 ]
  • symbol: NWMN_RS01365
  • product: formate/nitrite transporter
  • replicon: chromosome
  • strand: -
  • coordinates: 300845..301669
  • length: 825
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (300845..301669) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    GTGAAGGAGAAACATATTAAATGGGATAAGATTTTTTATGGGGACGACTGGGTAAATAAC
    GTAGTCGAAACGATAAGAACAAAAGATATATTACAAAGCGTTTATTTAAAACGTTATTTA
    TTACGCGCGATGATGGCAGGATTTATTATCGGGATTATTACGGTCTTCGTATTATCAGTT
    AAAGCAACACACGAACCAGATTTACCGCCAGGCATTGTGAATATGGCCAGTGCCATTACA
    TTCAGCTTTGCGTTAGTACTCATTTTATTTACAAACTCCGAACTACTAACCAGTAACTTC
    ATGTACTTTACTGTAGGCCTGTATTATAAAGTAATTAAACCAACTAGAGTATTGAAAATA
    TTTTTATTATGCTTTGCAGGAAATATTTTAGGTGCTGCTATTTTATTTAGTTTCATGCGT
    TTTTCAAATGTAATGACGCCAGATATGTTAAATCAGTTATCAGCAGTTATAGAGCATAAA
    ACGTTGTCTACTGGTTTTGTAAGTATATTAATGAAAGCGATCTTCGCCAATTTCTTTATC
    AATATTTCATTAGTTATTGCCATGCAAATTGACGATGTACTCGCAAAAATGTTTGTCATG
    ATGTTCGGTGTTACCATATTCGCCTTTATGGGTTATGAACACGTCGTTTACAACAGTTGC
    TTATTTATGGGTGGTTTAATTTATCAAGTTGATACATTGCACTTCATACCAGCTATTTCG
    AATATCGCTGCGGCTTTTATCGGTAACTATATTGGAGGCGGACTCATTATAGGTTTATTC
    TATGCTTACTTGAATGATCATCATCAATTTTATAAAAATAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    825

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01365 [old locus tag: NWMN_0247 ]
  • symbol: NWMN_RS01365
  • description: formate/nitrite transporter
  • length: 274
  • theoretical pI: 8.89564
  • theoretical MW: 31018.8
  • GRAVY: 0.727372

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsformate/nitrite transporter (TIGR00790; HMM-score: 128.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsformate transporter FocA (TIGR04060; HMM-score: 107.2)
  • TheSEED:
  • PFAM:
    no clan definedForm_Nir_trans; Formate/nitrite transporter (PF01226; HMM-score: 165.3)
    DUF1980; Domain of unknown function (DUF1980) (PF09323; HMM-score: 14.8)
    DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 7
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.197
    • Ymax_pos: 63
    • Cmax: 0.165
    • Cmax_pos: 63
    • Smax: 0.308
    • Smax_pos: 52
    • Smean: 0.089
    • D: 0.155
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI: 446582424 NCBI
  • RefSeq: WP_000659770 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMMAGFIIGIITVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIKPTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKAIFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTLHFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01365 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]