From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS03325 [old locus tag: NWMN_0581 ]
  • pan locus tag?: SAUPAN002476000
  • symbol: NWMN_RS03325
  • pan gene symbol?:
  • synonym:
  • product: ABC transporter substrate-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS03325 [old locus tag: NWMN_0581 ]
  • symbol: NWMN_RS03325
  • product: ABC transporter substrate-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 662655..663482
  • length: 828
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (662655..663482) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAGATAATGATAAACAAGGTAGCAATGATAATGGCTCGTCTAAATCGCCGTACCAT
    AGAATTGTTTCGTTAATGCCTAGTAATACTGAAATTTTATATGAATTAGGATTAGGTAAA
    TACATAGTTGGTGTTTCAACGGTTGATGATTATCCAAAAGATGTGAAAAAGGGTAAGAAA
    CAATTTGATGCTTTGAATCTAAATAAAGAGGAACTTTTAAAGGCAAAGCCAGATCTAATT
    CTTGCGCATGAGTCGCAAAAGGCAACTGCTAATAAAGTATTGTCATCATTAGAGAAACAA
    GGCATCAAAGTAGTGTATGTTAAAGATGCACAATCAATTGATGAAACTTACAACACATTT
    AAGCAAATTGGGAAATTAACGCATCATGATAAGCAGGCTGAACAACTTGTTGAGGAAACT
    AAAGATAATATCGATAAAGTCATAGATTCAATTCCTGCTCATCATAAAAAATCAAAAGTA
    TTTATTGAGGTTTCATCAAAGCCTGAAATATATACAGCAGGGAAGCATACATTTTTTAAT
    GATATGTTAGAAAAATTAGAAGCCCAAAATGTGTATAGTGACATTAATGGTTGGAACCCT
    GTAACGAAGGAAAGTATTATTAAAAAGAACCCAGATATATTAATTTCGACGGAAGCTAAG
    ACAAGATCAGATTATATGGATATCATCAAAAAAAGAGGTGGATTCAATAAAATTAATGCT
    GTCAAGAATACACGTATTGAAGTTGTAAATGGTGATGAAGTATCAAGACCAGGTCCACGT
    ATTGATGAAGGATTAAAAGAATTAAGAGATGCAATTTATAGAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    828

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS03325 [old locus tag: NWMN_0581 ]
  • symbol: NWMN_RS03325
  • description: ABC transporter substrate-binding protein
  • length: 275
  • theoretical pI: 9.40311
  • theoretical MW: 31088.1
  • GRAVY: -0.748364

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 125.3)
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 61.8)
    proposed F420-0 ABC transporter, periplasmic F420-0 binding protein (TIGR03868; HMM-score: 54.4)
  • TheSEED:
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 117.6)
    HTH (CL0123) F-112; F-112 protein (PF09645; HMM-score: 17.7)
    no clan definedMMR1; Mitochondrial Myo2 receptor-related protein (PF08505; HMM-score: 15)
    Chelatase (CL0043) Oxidored_nitro; Nitrogenase component 1 type Oxidoreductase (PF00148; HMM-score: 13.8)
    Periplas_BP (CL0144) Peripla_BP_4; Periplasmic binding protein domain (PF13407; HMM-score: 13.4)
    SIS (CL0067) DUF2529; Domain of unknown function (DUF2529) (PF10740; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 14
    • Cmax: 0.111
    • Cmax_pos: 34
    • Smax: 0.192
    • Smax_pos: 12
    • Smean: 0.151
    • D: 0.135
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001813976 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKDNDKQGSNDNGSSKSPYHRIVSLMPSNTEILYELGLGKYIVGVSTVDDYPKDVKKGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQGIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKVFIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAKTRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS03325 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]