From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS03855 [old locus tag: NWMN_0682 ]
  • pan locus tag?: SAUPAN002599000
  • symbol: NWMN_RS03855
  • pan gene symbol?: pabA
  • synonym:
  • product: aminodeoxychorismate/anthranilate synthase component II

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS03855 [old locus tag: NWMN_0682 ]
  • symbol: NWMN_RS03855
  • product: aminodeoxychorismate/anthranilate synthase component II
  • replicon: chromosome
  • strand: +
  • coordinates: 762711..763304
  • length: 594
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (762711..763304) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTCTAGTCATAGATAATAATGATTCATTTACATATAATTTAATAGACTATATTAAG
    ACTCAAACGAAACTAACAGTTCAAGTTGTTGGTATTGATAATCTGCTGATAGAAGACGTC
    ATTAATATGAAGCCAAAAGCAATTGTTATTTCGCCTGGGCCGGGTAATCCGGATGATTAT
    CCTATCTTGAATGAAGTGTTAGAACAATTTTATCAGCGTGTACCTATACTAGGTGTATGT
    TTAGGATTTCAATGTATCGTGTCTTATTTTGGTGGAAATATCATTCACGGCTATCATCCT
    GTACACGGACATACTACACAGTTACGCCATACCAATGAAGGTATTTTTCAAGGACTGCCT
    CAAAATTTCAATGTAATGCGTTATCATTCATTAATTGCTGACGGAGCGACTTTTCCAAAT
    TGCTTAAAGATTACAGCAAAAAACGATGAAGCGATTATTATGGCATTTGAGCATATTAGA
    TTTCCGGTTTTTGGTGTGCAATATCATCCTGAATCTATTTTGAGTGAATACGGTTATCGA
    CAAGTTGAATTATTTTTATCGAAGGTAGGTGATTACTGTGAGAATAGAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    594

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS03855 [old locus tag: NWMN_0682 ]
  • symbol: NWMN_RS03855
  • description: aminodeoxychorismate/anthranilate synthase component II
  • length: 197
  • theoretical pI: 5.79556
  • theoretical MW: 22377.5
  • GRAVY: 0.0126904

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 184.5)
    MetabolismAmino acid biosynthesisAromatic amino acid familyanthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 154.8)
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 140.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 90.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 62.5)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 18.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 15.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 12.2)
  • TheSEED:
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 153.5)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 41.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS10565(gatA)glutamyl-tRNA(Gln) amidotransferase subunit A  [1] (data from MRSA252)
    NWMN_RS00980L-lactate dehydrogenase  [1] (data from MRSA252)
    NWMN_RS0657530S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_RS08865aldehyde dehydrogenase  [1] (data from MRSA252)
    NWMN_RS11655uracil phosphoribosyltransferase  [1] (data from MRSA252)
    NWMN_RS14010pyruvate oxidase  [1] (data from MRSA252)
    NWMN_RS14060hydroxymethylglutaryl-CoA synthase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 51
    • Cmax: 0.108
    • Cmax_pos: 58
    • Smax: 0.179
    • Smax_pos: 43
    • Smean: 0.095
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446527168 NCBI
  • RefSeq: WP_000604514 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDYPILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLPQNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYRQVELFLSKVGDYCENRI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS03855 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]