From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11655 [old locus tag: NWMN_2016 ]
  • pan locus tag?: SAUPAN005403000
  • symbol: NWMN_RS11655
  • pan gene symbol?: upp
  • synonym:
  • product: uracil phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11655 [old locus tag: NWMN_2016 ]
  • symbol: NWMN_RS11655
  • product: uracil phosphoribosyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2233316..2233945
  • length: 630
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2233316..2233945) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGTAAAGTACACGTTTTCGATCATCCATTAATTCAACACAAACTAAGCTATATTAGA
    GATGTAAATACAGGTACTAAAGAATTTAGAGAACTTGTAGACGAAGTTGGTATGTTGATG
    GCATATGAAGTAACTAGAGACTTAGAGCTTCAGGATGTTGATATTGAAACGCCTGTAACT
    AAAATGACGGCTAAACGATTAGCTGGTAAAAAATTAGCTATCGTTCCAATTTTAAGAGCT
    GGTTTAGGTATGACTGATGGTATTTTAAGTTTAGTACCTGCAGCCAGAGTTGGACATATC
    GGTTTATATCGAGATCCCGAAACATTAAAGGCTGTAGAGTATTTTGCTAAGTTACCTCAA
    GATATTACTGAAAGACAAATCATTGTTGTTGATCCTATGTTAGCAACAGGCGCATCAGCA
    ATTGAAGCTATTACTTCATTGAAGAAACGTGGCGCTAAAAATATTCGCTTCATGTGTTTA
    ATTGCAGCACCAGAAGGCGTAGAAAAGATGCATGAAGCACATCCAGATGTAGATATTTAT
    ATTGCTGCACTTGATGAAAAGCTAAATGACAAAGCATATATCACACCAGGGTTAGGCGAC
    GCTGGAGATAGATTGTTTGGTACTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    630

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11655 [old locus tag: NWMN_2016 ]
  • symbol: NWMN_RS11655
  • description: uracil phosphoribosyltransferase
  • length: 209
  • theoretical pI: 6.52063
  • theoretical MW: 23049.7
  • GRAVY: -0.0320574

Function[edit source | edit]

  • reaction:
    EC 2.4.2.9?  ExPASy
    Uracil phosphoribosyltransferaseUMP + diphosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 304.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 27.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 23)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 22.8)
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 17.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 12.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    PRTase-like (CL0533) UPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 258.9)
    Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 42.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:
    NWMN_RS0292050S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_RS02965elongation factor Tu  [1] (data from MRSA252)
    NWMN_RS05380pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    NWMN_RS05385pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    NWMN_RS05390dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS05395dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    NWMN_RS0657530S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_RS07455dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS1240050S ribosomal protein L22  [1] (data from MRSA252)
    NWMN_RS1241050S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_RS14105L-glutamate gamma-semialdehyde dehydrogenase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 21
    • Cmax: 0.103
    • Cmax_pos: 26
    • Smax: 0.117
    • Smax_pos: 11
    • Smean: 0.099
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445970857 NCBI
  • RefSeq: WP_000048712 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKVHVFDHPLIQHKLSYIRDVNTGTKEFRELVDEVGMLMAYEVTRDLELQDVDIETPVTKMTAKRLAGKKLAIVPILRAGLGMTDGILSLVPAARVGHIGLYRDPETLKAVEYFAKLPQDITERQIIVVDPMLATGASAIEAITSLKKRGAKNIRFMCLIAAPEGVEKMHEAHPDVDIYIAALDEKLNDKAYITPGLGDAGDRLFGTK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11655 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]