From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06240 [old locus tag: NWMN_1102 ]
  • pan locus tag?: SAUPAN003463000
  • symbol: NWMN_RS06240
  • pan gene symbol?:
  • synonym:
  • product: cell division protein DivIVA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06240 [old locus tag: NWMN_1102 ]
  • symbol: NWMN_RS06240
  • product: cell division protein DivIVA
  • replicon: chromosome
  • strand: +
  • coordinates: 1206249..1206866
  • length: 618
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1206249..1206866) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGCCTTTTACACCAAATGAAATTAAGAATAAAGAGTTTTCACGTGTAAAGAATGGTTTA
    GAACCTACTGAAGTTGCTAATTTTTTGGAGCAACTAAGCACTGAAATTGAACGTCTTAAA
    GAAGATAAAAAACAACTTGAAAAAGTAATCGAAGAGAGAGATACTAATATTAAGTCTTAT
    CAAGACGTGCATCAATCTGTAAGTGATGCTTTGATACAAGCTCAAAAAGCTGGTGAAGAA
    ACTAAGCAAGCTGCAGAGAAACAAGCTGAAGCGATTATAGCTAAGGCAGAAGCGCAAGCT
    AATCAAATGGTTGGTGACGCGGTAGAAAAAGCACGCCGTTTAGCATTCCAGACTGAAGAT
    ATGAAACGTCAATCAAAAGTATTTAGATCGCGTTTCCGTATGTTAGTTGAAGCGCAATTA
    GACTTATTAAAAAACGAAGATTGGGATTACTTGTTGAATTATGATTTAGACGCTGAACAA
    GTGACGCTTGAAAATATTCATCATTTGCATGAAAATGATTTAAAGCCAGATGAAGTTGCA
    GCAAATGCACAAAATAATGCATCAAATACACCAGACAATAATCAACAATCCAATGATTCA
    GAAACAACTAAGAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06240 [old locus tag: NWMN_1102 ]
  • symbol: NWMN_RS06240
  • description: cell division protein DivIVA
  • length: 205
  • theoretical pI: 4.63557
  • theoretical MW: 23513.8
  • GRAVY: -1.00683

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    DivIVA domain (TIGR03544; HMM-score: 29.9)
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 12.7)
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein B (TIGR02976; HMM-score: 10.8)
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 5.6)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 4.9)
    SH3 domain protein (TIGR04211; HMM-score: 4.8)
  • TheSEED:
  • PFAM:
    no clan definedDivIVA; DivIVA protein (PF05103; HMM-score: 119.1)
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 18.1)
    no clan definedLeu_zip; Leucine zipper (PF15294; HMM-score: 17.7)
    CDA (CL0109) APOBEC_N; APOBEC-like N-terminal domain (PF08210; HMM-score: 13.7)
    no clan definedDUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 12.1)
    HAD (CL0137) 5_nucleotid; 5' nucleotidase family (PF05761; HMM-score: 12)
    no clan definedDUF2570; Protein of unknown function (DUF2570) (PF10828; HMM-score: 11.7)
    ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 11.6)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.9)
    KELK; KELK-motif containing domain of MRCK Ser/Thr protein kinase (PF15796; HMM-score: 10.6)
    ZYG-11_interact; Interactor of ZYG-11 (PF05884; HMM-score: 9.5)
    Dak2; DAK2 domain (PF02734; HMM-score: 9.5)
    CENP-F_leu_zip; Leucine-rich repeats of kinetochore protein Cenp-F/LEK1 (PF10473; HMM-score: 9.1)
    DUF349; Domain of Unknown Function (DUF349) (PF03993; HMM-score: 8.7)
    YjbJ-CsbD-like (CL0406) DUF883; Bacterial protein of unknown function (DUF883) (PF05957; HMM-score: 7.8)
    no clan definedYtxH; YtxH-like protein (PF12732; HMM-score: 7.6)
    NADP_Rossmann (CL0063) NAD_binding_5; Myo-inositol-1-phosphate synthase (PF07994; HMM-score: 7.3)
    no clan definedLMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 6.6)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 6.2)
    DASH_Spc19; Spc19 (PF08287; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.153
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 42
    • Smax: 0.334
    • Smax_pos: 4
    • Smean: 0.238
    • D: 0.186
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447039808 NCBI
  • RefSeq: WP_001117064 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSYQDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTEDMKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVAANAQNNASNTPDNNQQSNDSETTKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06240 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]