From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06975 [old locus tag: NWMN_1235 ]
  • pan locus tag?: SAUPAN003692000
  • symbol: NWMN_RS06975
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06975 [old locus tag: NWMN_1235 ]
  • symbol: NWMN_RS06975
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1358985..1359173
  • length: 189
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1358985..1359173) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
    GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
    TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
    AAAAATTAG
    60
    120
    180
    189

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06975 [old locus tag: NWMN_1235 ]
  • symbol: NWMN_RS06975
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3273
  • theoretical MW: 6956.53
  • GRAVY: 1.55323

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsbile acid transporter (TIGR00841; HMM-score: 11.5)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
    cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
  • TheSEED:
  • PFAM:
    MviN_MATE (CL0222) Polysacc_synt_C; Polysaccharide biosynthesis C-terminal domain (PF14667; HMM-score: 17.6)
    no clan definedDUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 17.3)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 16.1)
    no clan definedDUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.7)
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.2)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11.9)
    DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 11.6)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 11.5)
    Peptidase_AD (CL0130) Peptidase_A24; Type IV leader peptidase family (PF01478; HMM-score: 11.5)
    no clan definedMyc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.8)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 10.3)
    no clan definedDUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.1)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.9)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 8.6)
    no clan definedDUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.4)
    Ninjurin; Ninjurin (PF04923; HMM-score: 8)
    Phage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 7.5)
    IT (CL0182) CitMHS; Citrate transporter (PF03600; HMM-score: 7.3)
    no clan definedLapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.1)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 7)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 6.6)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 6.5)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 30
    • Smax: 0.135
    • Smax_pos: 1
    • Smean: 0.105
    • D: 0.104
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446949887 NCBI
  • RefSeq: WP_001027143 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06975 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]