From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • pan locus tag?: SAUPAN003853000
  • symbol: NWMN_RS07515
  • pan gene symbol?: crr
  • synonym:
  • product: glucose-specific phosphotransferase enzyme IIA component

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • symbol: NWMN_RS07515
  • product: glucose-specific phosphotransferase enzyme IIA component
  • replicon: chromosome
  • strand: -
  • coordinates: 1467560..1468060
  • length: 501
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1467560..1468060) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTTTAAAAAATTATTCGGAAAAGGCAAAGAAGTTCAGAAAGATATCGCAATTTATGCA
    CCATTAACTGGAGAATTCGTGAAAATTGAAGATATTCCAGATCCTGTATTCGCACAAAAA
    ATGATGGGCGAAGGTTTTGGTATTAATCCAACTGAAGGAGAAGTTGTGTCTCCAATTGCA
    GGACGTGTTGACAATGTCTTTCCAACTAAGCATGCGATTGGGTTAAAAGCAGATAACGGA
    TTAGAATTATTAGTTCATATCGGTTTAGACACAGTTCAATTAGACGGTGAAGGATTTGAA
    GTGTTAGTGTCTAGTGGTGACGAAGTTAACGTCGGAGATCCATTAGTAAGATTCAACCTT
    GAATATATTAATAATAACGCTAAATCTGTAATTTCACCAATTATAATTACTAACACTGAT
    CAAGCAGCTTCAATTAATATTTATGATGAAAATGCTGTGATTAAAGGTGAAACAAAAGTG
    ATTGATGTGACAATGAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • symbol: NWMN_RS07515
  • description: glucose-specific phosphotransferase enzyme IIA component
  • length: 166
  • theoretical pI: 4.26969
  • theoretical MW: 17960.4
  • GRAVY: 0.0162651

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    PTS system, beta-glucoside-specific IIABC component (TIGR01995; EC 2.7.1.69; HMM-score: 179.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 152.3)
    Signal transductionSignal transductionPTSPTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 152.3)
  • TheSEED:
  • PFAM:
    Hybrid (CL0105) PTS_EIIA_1; phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 (PF00358; HMM-score: 177.6)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 18.8)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 13.3)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 39
    • Cmax: 0.172
    • Cmax_pos: 39
    • Smax: 0.144
    • Smax_pos: 2
    • Smean: 0.091
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446395797 NCBI
  • RefSeq: WP_000473652 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIAGRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNLEYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS07515 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]