From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
  • pan locus tag?: SAUPAN005018000
  • symbol: NWMN_RS10795
  • pan gene symbol?: scn
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
  • symbol: NWMN_RS10795
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2089433..2089783
  • length: 351
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2089433..2089783) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
    GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
    TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
    GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCAA
    AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
    CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA
    60
    120
    180
    240
    300
    351

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
  • symbol: NWMN_RS10795
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.83807
  • theoretical MW: 13067
  • GRAVY: -0.516379

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    integral membrane protein (TIGR04561; HMM-score: 12.8)
  • TheSEED:
  • PFAM:
    no clan definedCompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 162.7)
    EcoR124_C; Type I restriction and modification enzyme - subunit R C terminal (PF12008; HMM-score: 18.4)
    IDEAL; IDEAL domain (PF08858; HMM-score: 17.4)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 14.6)
    Minor_capsid_3; Minor capsid protein from bacteriophage (PF12691; HMM-score: 13.1)
    HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 12.9)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 32 aa
    • Ymax: 0.666
    • Ymax_pos: 32
    • Cmax: 0.619
    • Cmax_pos: 32
    • Smax: 0.925
    • Smax_pos: 16
    • Smean: 0.813
    • D: 0.723
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446624917 NCBI
  • RefSeq: WP_000702263 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10795 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]