From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11555 [old locus tag: NWMN_1997 ]
  • pan locus tag?: SAUPAN005375000
  • symbol: NWMN_RS11555
  • pan gene symbol?: thiD
  • synonym:
  • product: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11555 [old locus tag: NWMN_1997 ]
  • symbol: NWMN_RS11555
  • product: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 2218383..2219213
  • length: 831
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2218383..2219213) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATTAAACCTAAAATAGCATTAACCATTGCAGGTACTGATCCAACAGGTGGTGCCGGC
    GTAATGGCTGATTTAAAATCATTTCATTCATGTGGTGTATATGGTATGGGCGTCGTTACA
    AGTATTGTTGCTCAAAATACATTGGGCGTACAACATATTCATAATTTAAATCATCAATGG
    GTAGATGAACAACTTGATAGTGTCTTCAATGATACCTTACCTCATGCTATTAAAACGGGG
    ATGATTGCTACAGCAGATACTATGGAAACGATTCGTCATTATTTAATGCAACATGAATCT
    ATTCCATATGTAATTGATCCTGTTATGTTGGCGAAAAGCGGTGATTCATTAATGGATAAT
    GACACAAAGCAAAACTTGCAGCATACGTTATTGCCATTAGCTGACGTAGTAACACCGAAT
    TTACCAGAAGCTGAAGAAATAACGGGACTAACCATTGATAGTGAAGAAAAAATTATGCAG
    GCTGGCCGCATCTTTATTAATGAGATTGGTAGTAAAGGTGTCATCATTAAAGGCGGTCAT
    TCAAATGATACTGATATAGCAAAAGATTATTTATTTACTAACGAAGGTGTTCAAACATTT
    GAAAATGAACGATTTAAAACAAAACATACGCATGGAACAGGGTGTACATTTTCAGCAGTT
    ATAACGGCAGAACTTGCAAAAGGTAGACCATTATTTGAGGCTGTACACAAGGCTAAAAAG
    TTTATTTCAATGAGTATACAATATACGCCTGAAATCGGCCGTGGTAGAGGTCCAGTGAAT
    CATTTTGCATATTTAAAGAAAGAGGGATTAGACGATGAATTATCTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11555 [old locus tag: NWMN_1997 ]
  • symbol: NWMN_RS11555
  • description: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • length: 276
  • theoretical pI: 6.18122
  • theoretical MW: 30228.3
  • GRAVY: -0.223551

Function[edit source | edit]

  • reaction:
    EC 2.7.4.7?  ExPASy
    Phosphomethylpyrimidine kinaseATP + 4-amino-2-methyl-5-(phosphomethyl)pyrimidine = ADP + 4-amino-2-methyl-5-(diphosphomethyl)pyrimidine
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminehydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 312)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal kinase (TIGR00687; EC 2.7.1.35; HMM-score: 57.6)
    MetabolismEnergy metabolismSugarsribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 42)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 24.4)
    hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 23)
    1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 19.8)
  • TheSEED:
  • PFAM:
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 311.1)
    PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 47.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.212
    • Ymax_pos: 53
    • Cmax: 0.219
    • Cmax_pos: 24
    • Smax: 0.416
    • Smax_pos: 42
    • Smean: 0.224
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446517613 NCBI
  • RefSeq: WP_000594959 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQWVDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDNDTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGVIIKGGHSNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKKFISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11555 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]