From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13450 [old locus tag: NWMN_2336 ]
  • pan locus tag?: SAUPAN005985000
  • symbol: NWMN_RS13450
  • pan gene symbol?:
  • synonym:
  • product: phosphohydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13450 [old locus tag: NWMN_2336 ]
  • symbol: NWMN_RS13450
  • product: phosphohydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 2566019..2566825
  • length: 807
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2566019..2566825) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAGATAGGGACAATCGCCGATTTACATATTGATCGTCATAATAAAAAAACATCCGAA
    GATTACTTAGAGGCATTGGTTGAAATAGTTAAGTATAAGAAATTGGATATATTGTTGATT
    GCGGGGGATATCTCAAATCATTATCAATTGACGCACCAATTTATAACGCAATTGACAAAA
    CAATTAGATATACCTGTGAAATTTGTACCTGGAAACCATGATTTATGGGAAGTTGAAAGT
    ATGACTACGCAAGACATTTGGAATAATTATAAGAGTATGTCACAGTGCTTGGTAGGAAAA
    CCATTTATAGTAAATGAAGAATGGGCAATCATAGGACATACTGGCTGGTATGATTATAGC
    TTTGCAGCACAACGATTTTCATTAGATGAGTTACAAAAAGGAAAACATTATGGTGCGACT
    TGGCAAGATAAAGAACGAATATCTTGGGGCATATCAGATCAAAATTTATCTAAAATAGCG
    GCTGAACAAGTGAAGAAAGATATATTAGAAGTAGGAAATAGACGAGTGATTTTAGTCACA
    CATGTTGTGACGCACCCTGATTTCATTGTTCCTATGCCGCATCGTATATTCGATTTTTAT
    AATGCATTTATTGGGACAAGTGATTTCAATCCTTTGTATGCGATGTTCGATATACCATAT
    AGTATTATGGGCCATGTTCATTTTCGTAAAAGTGTGATAGATGATGGCAGATGTTATCTC
    TGTCCGTGTCTAGGCTATCCAAGACAATGGCGTTCAGAAGATATTTACCAGGAAATAAAT
    GAGACGATACAAATAATAGAAATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    807

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13450 [old locus tag: NWMN_2336 ]
  • symbol: NWMN_RS13450
  • description: phosphohydrolase
  • length: 268
  • theoretical pI: 6.22779
  • theoretical MW: 31298.6
  • GRAVY: -0.28209

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative phosphoesterase (TIGR03729; HMM-score: 284.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexonuclease SbcCD, D subunit (TIGR00619; HMM-score: 25.2)
    Unknown functionEnzymes of unknown specificityphosphodiesterase, MJ0936 family (TIGR00040; EC 3.1.-.-; HMM-score: 21.8)
    TIGR04168 family protein (TIGR04168; HMM-score: 21.1)
    metallophosphoesterase, DNA ligase-associated (TIGR04123; HMM-score: 19.9)
    Unknown functionEnzymes of unknown specificityputative phosphoesterase (TIGR00024; EC 3.1.-.-; HMM-score: 15.7)
  • TheSEED:
  • PFAM:
    Calcineurin (CL0163) Metallophos; Calcineurin-like phosphoesterase (PF00149; HMM-score: 49.4)
    Metallophos_2; Calcineurin-like phosphoesterase superfamily domain (PF12850; HMM-score: 40.2)
    Metallophos_3; Metallophosphoesterase, calcineurin superfamily (PF14582; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 44
    • Cmax: 0.112
    • Cmax_pos: 54
    • Smax: 0.107
    • Smax_pos: 32
    • Smean: 0.073
    • D: 0.088
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446612851 NCBI
  • RefSeq: WP_000690197 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTKQLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYSFAAQRFSLDELQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVTHVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVIDDGRCYLCPCLGYPRQWRSEDIYQEINETIQIIEI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13450 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]