From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13785 [old locus tag: NWMN_2394 ]
  • pan locus tag?: SAUPAN006110000
  • symbol: NWMN_RS13785
  • pan gene symbol?: sarU
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13785 [old locus tag: NWMN_2394 ]
  • symbol: NWMN_RS13785
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2633324..2634067
  • length: 744
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2633324..2634067) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGGACTATCAAACTTTCGAAAAGGTCAATAAATTCATAAATGTAAAAGCGTACATATTT
    TTTCTCACTCAAGAGTTAAAGCAACAATATAAATTATCATTAAAAGAATTGTTGATATTA
    GCATATTTTTATTACAAAAATGAACACAGTATTTCACTAAAAGAAATCATTGGTGACATA
    CTTTACAAACAATCTGATGTTGTAAAGAACATTAAGTCACTATCTAAAAAAGGATTTATA
    AATAAGTCTAGAAACGAAGCAGATGAACGCCGTATTTTTGTTTCAGTTACTCCAATACAA
    CGTAAAAAGATTGCTTGTGTTATTAATGAGTTAGATAAAATAATTAAAGGATTTAATAAG
    GAAAGAGACTACATAAAATATCAATGGGCTCCAAAATATAGCAAAGAATTTTTTATACTT
    TTTATGAACATTATGTACTCAAAAGATTTTTTAAAATATCGATTTAATTTAACATTTCTT
    GATTTATCTATCTTATATGTAATATCATCTCGAAAAAATGAGATACTAAATTTAAAAGAT
    TTGTTTGAAAGTATTAGATTTATGTATCCTCAAATTGTTAGGTCAGTTAATAGATTAAAT
    AATAAAGGTATGCTAATCAAAGAACGATCCCTTGCAGATGAAAGGATTGTGTTAATCAAA
    ATAAATAAAATACAATATAACACTATTAAAAGCATATTCACAGATACTTCCAAGATTCTC
    AAACCAAGAAAATTTTTCTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13785 [old locus tag: NWMN_2394 ]
  • symbol: NWMN_RS13785
  • description: transcriptional regulator
  • length: 247
  • theoretical pI: 10.4105
  • theoretical MW: 29792
  • GRAVY: -0.246964

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 209.5)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 35.4)
  • TheSEED:
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 36.3)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 34.9)
    MarR_2; MarR family (PF12802; HMM-score: 29.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19.2)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 14.3)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 14.1)
    OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.098
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 29
    • Smax: 0.127
    • Smax_pos: 2
    • Smean: 0.096
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446308514 NCBI
  • RefSeq: WP_000386369 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDILYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNKERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKDLFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKILKPRKFFF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13785 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]