From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0129 [new locus tag: SA_RS00810 ]
  • pan locus tag?: SAUPAN000943000
  • symbol: SA0129
  • pan gene symbol?: sasD
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0129 [new locus tag: SA_RS00810 ]
  • symbol: SA0129
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 149019..149744
  • length: 726
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAAAATTAGCAACAGTAGGTTCTTTAATTGTAACAAGCACTTTAGTATTCTCAAGT
    ATGCCTTTTCAAAATGCGCATGCCGACACGACTTCAATGAATGTGCCGAATAAACAAAGC
    CAAAATGTACAAAATCATCGCCCTTATGGCGGAGTAGTACCACAAGGAATGACGCAAGCA
    CAATATACTGAATTAGAGAAAACTTTACCCCAATTAAGCGCTGGCAGTAATATGCAAGAC
    TATAATATGAAATTGTATGATGCGACGCAAAATATTGCTGATAAATACAATGTGATAATT
    ACAACTAATGTAGGGGTATTTAAACCACATGCTGTTAGAGATATGAATGGCCATGCGTTA
    CCTTTAACAAAAGATGGCAATTTTTATCAAACGAATGTAGATGCAAATGGTGTTAATCAT
    GGTGGTAGTGAAATGGTGCAAAATAAAACAGGTCATATGAGTCAACAAGACCATATGAAT
    CAGAACACACACATGAACCAACAGCCACAAATACAACAAGGTCATATGCAATCATCAAAC
    CATCAAATGATGAGTCCAAAAGCAAATATGCATTCATCAAATCATCAAATGAACCAAAGT
    AACAAAAAAGTTTTACCAGCTGCTGGTGAAAGTATGACATCAAGTATTCTTACTGCAAGT
    ATTGCCGCACTACTATTAGTATCTGGGTTATTCTTAGCATTTAGACGACGTTCAACAAAT
    AAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    726

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0129 [new locus tag: SA_RS00810 ]
  • symbol: SA0129
  • description: hypothetical protein
  • length: 241
  • theoretical pI: 10.0806
  • theoretical MW: 26527.8
  • GRAVY: -0.605394

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 20.7)
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionAdhesins in Staphylococcus Predicted cell-wall-anchored protein SasD (LPXAG motif) 
  • PFAM:
    no clan definedGram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 28.1)
    FAM220; FAM220 family (PF15487; HMM-score: 12.7)
    TFIIA; Transcription factor IIA, alpha/beta subunit (PF03153; HMM-score: 8.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 10
    • Extracellular Score: 0
    • Internal Helices: 2
  • LocateP: LPxTG Cell-wall anchored
    • Prediction by SwissProt Classification: Cell Wall
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: found LPxTG motif :LPAAG
  • SignalP: Signal peptide length 29 aa
    • Ymax: 0.86
    • Ymax_pos: 29
    • Cmax: 0.821
    • Cmax_pos: 29
    • Smax: 0.954
    • Smax_pos: 19
    • Smean: 0.891
    • D: 0.872
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVPNKQSQNVQNHRPYGGVVPQGMTQAQYTELEKTLPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHALPLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQDHMNQNTHMNQQPQIQQGHMQSSNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRSTNK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]