From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0168 [new locus tag: SA_RS01015 ]
  • pan locus tag?: SAUPAN001012000
  • symbol: SA0168
  • pan gene symbol?: ssuC
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0168 [new locus tag: SA_RS01015 ]
  • symbol: SA0168
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 191531..192292
  • length: 762
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACACGTCCCACAAATAACAAATTTATATTACCTATTATCACATTTATTATTTTCTTA
    GGCATTTGGGAAATGGTCATTATTATTGGGCATTACCAACCTGTATTGTTACCTGGTCCT
    GCTCTTGTAGGAAAAAGTATATGGACTTTCATTGTTACTGGAGAAATTTTCCAACATTTA
    GCAATTAGTTTATGGAGATTTGTAGCGGGCTTTGTTGTCGCATTGTTGGTTGCTATTCCA
    TTGGGCTTCTTGCTTGGAAGGAATCGTTGGCTATACAACGCTATCGAACCGCTATTTCAA
    TTGATTAGACCGATATCTCCGATAGCATGGGCACCATTTGTTGTTCTATGGTTTGGTATT
    GGTAGTTTGCCAGCGATTGCGATTATTTTTATCGCTGCTTTTTTCCCAATTGTGTTCAAT
    ACTATTAAAGGCGTTAGAGACATTGAACCTCAATATTTAAAAATAGCGGCAAATTTAAAT
    TTAACTGGGTGGTCATTGTATCGCAATATATTATTTCCCGGGGCATTTAAACAAATCATG
    GCTGGGATACATATGGCGGTAGGAACAAGTTGGATATTTTTAGTTTCTGGTGAAATGATT
    GGTGCACAATCGGGATTAGGTTTTTTAATCGTTGATGCACGAAATATGTTGAACTTAGAA
    GATGTTTTAGCAGCAATATTCTTTATCGGATTATTTGGTTTTATTATTGATCGATTCATT
    AGTTATATTGAGCAGTTTATACTTAGAAGATTTGGTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    762

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0168 [new locus tag: SA_RS01015 ]
  • symbol: SA0168
  • description: hypothetical protein
  • length: 253
  • theoretical pI: 10.0243
  • theoretical MW: 28446
  • GRAVY: 0.96996

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, permease protein (TIGR01183; HMM-score: 140.3)
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 61.8)
    NifC-like ABC-type porter (TIGR01581; HMM-score: 27)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 25.5)
    2-aminoethylphosphonate ABC transporter, permease protein (TIGR03226; HMM-score: 20.7)
  • TheSEED:  
    ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 83.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 11
    • Cmax: 0.114
    • Cmax_pos: 33
    • Smax: 0.233
    • Smax_pos: 3
    • Smean: 0.167
    • D: 0.144
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWTFIVTGEIFQHLAISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGIGSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIMAGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFISYIEQFILRRFGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1453 (CymR*)
    CymR* (TF) important in Cysteine metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Olga Soutourina, Sarah Dubrac, Olivier Poupel, Tarek Msadek, Isabelle Martin-Verstraete
The pleiotropic CymR regulator of Staphylococcus aureus plays an important role in virulence and stress response.
PLoS Pathog.: 2010, 6(5);e1000894
[PubMed:20485570] [WorldCat.org] [DOI] (I e)