From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0273 [new locus tag: SA_RS01600 ]
  • pan locus tag?: SAUPAN001177000
  • symbol: SA0273
  • pan gene symbol?: essA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0273 [new locus tag: SA_RS01600 ]
  • symbol: SA0273
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 330478..330936
  • length: 459
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTGATGAATAGCGTGATTGCTTTAACTTTTTTAACAGCATCTAGCAATAATGGCGGA
    CTTAATATTGATGTGCAACAAGAAGAGGAAAAGCGAATCAATAATGATTTAAATCAATAT
    GATACAACGCTATTTAATAAAGATAGTAAAGAAGTCAACGACGCGATTGCTAAGCAGAAA
    AAAGAACGACAACAACAAATAAAAAATGATATGTTTCAAAATCAAGCGAGTCACTCGACT
    CGCTTGAATGAAACTAAAAAAGTGTTATTTTCCAAATCTAACTTAGAAAAGACTTCGGAG
    AGTGATAAAAGCCCCTATATTCAAAACAAGCAGGAGAAAAAAATATTCCCGTACATTTTG
    ATGTCTGTAGGGGCTTTTTTGACTTTAGGATTTGTCATTTTTTCAATTCATAAAGGGAGA
    CGAACGAAAAATGAATCAGCACGTAAAAGTAACATTTGA
    60
    120
    180
    240
    300
    360
    420
    459

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0273 [new locus tag: SA_RS01600 ]
  • symbol: SA0273
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 10.2803
  • theoretical MW: 17450.6
  • GRAVY: -0.803289

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 115.5)
  • TheSEED:  
    Membrane TransportProtein secretion system, Type VIIESAT-6 proteins secretion system in Firmicutes Putative secretion system component EssA 
  • PFAM:
    no clan definedEssA; WXG100 protein secretion system (Wss), protein EssA (PF10661; HMM-score: 28.6)
    DUF2370; Protein of unknown function (DUF2370) (PF10176; HMM-score: 16.6)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 15.3)
    YrhC; YrhC-like protein (PF14143; HMM-score: 14.5)
    NFRKB_winged; NFRKB Winged Helix-like (PF14465; HMM-score: 13.6)
    DUF2149; Uncharacterized conserved protein (DUF2149) (PF09919; HMM-score: 12.9)
    PIRT; Phosphoinositide-interacting protein family (PF15099; HMM-score: 12.7)
    Tcp10_C; T-complex protein 10 C-terminus (PF07202; HMM-score: 10.1)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 9.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.304
    • Ymax_pos: 24
    • Cmax: 0.17
    • Cmax_pos: 24
    • Smax: 0.775
    • Smax_pos: 1
    • Smean: 0.589
    • D: 0.415
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKEVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]