From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00259
  • pan locus tag?: SAUPAN001177000
  • symbol: SAOUHSC_00259
  • pan gene symbol?: essA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00259
  • symbol: SAOUHSC_00259
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 279337..279795
  • length: 459
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTGATGAATAGCGTGATTGCTTTAACTTTTTTAACAGCATCTAGCAATAATGGCGGA
    CTTAATATTGATGTGCAACAAGAAGAGGAAAAGCGAATCAATAATGATTTAAATCAATAT
    GATACAACGCTATTTAATAAAGACAGCAAAGCGGTTAATGATGCGATTGCTAAGCAGAAA
    AAAGAACGACAACAACAAATAAAAAATGATATGTTTCAAAATCAAGCGAGTCACTCGACT
    CGCTTGAATGAAACTAAAAAAGTGTTATTTTCCAAATCTAACTTAGAAAAGACTTCGGAG
    AGTGATAAAAGCCCCTATATTCAAAACAAGCAGGAGAAAAAAATATTCCCGTACATTTTG
    ATGTCTGTAGGGGCTTTTTTGACTTTAGGATTTGTCATTTTTTCAATTCATAAAGGGAGA
    CGAACGAAAAATGAATCAGCACGTAAAAGTAACATTTGA
    60
    120
    180
    240
    300
    360
    420
    459

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00259
  • symbol: SAOUHSC_00259
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 10.3846
  • theoretical MW: 17392.6
  • GRAVY: -0.768421

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 113.3)
  • TheSEED:  
    Membrane TransportProtein secretion system, Type VIIESAT-6 proteins secretion system in Firmicutes Putative secretion system component EssA 
  • PFAM:
    no clan definedEssA; WXG100 protein secretion system (Wss), protein EssA (PF10661; HMM-score: 27.4)
    DUF2370; Protein of unknown function (DUF2370) (PF10176; HMM-score: 16.4)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 16.1)
    YrhC; YrhC-like protein (PF14143; HMM-score: 14.5)
    PIRT; Phosphoinositide-interacting protein family (PF15099; HMM-score: 12.6)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.306
    • Ymax_pos: 24
    • Cmax: 0.17
    • Cmax_pos: 24
    • Smax: 0.785
    • Smax_pos: 1
    • Smean: 0.597
    • D: 0.419
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]