From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001177000
  • symbol?: essA
  • description?: protein EssA

      descriptions from strain specific annotations:

    • protein EssA
    • Putative secretion system component EssA
    • Virulence Protein essA
    • protein EssA (Precursor)
    • protein secretion system EssA
    • pseudogene
    • type VII secretion protein EssA
  • strand?: +
  • coordinates?: 1446675..1447133
  • synteny block?: BlockID0006960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0284 (essA)
    08BA02176:
    C248_0274 (essA)
    11819-97:
    MS7_0275 (essA)
    71193:
    ST398NM01_0299
    ECT-R 2:
    ECTR2_245
    ED133:
    SAOV_0227
    ED98:
    SAAV_0252
    HO 5096 0412:
    SAEMRSA15_02430
    JH1:
    SaurJH1_0275
    JH9:
    SaurJH9_0268
    JKD6008:
    SAA6008_00258 (essA)
    JKD6159:
    SAA6159_00265 (essA)
    LGA251:
    SARLGA251_02480 (essA)
    M013:
    M013TW_0265
    MRSA252:
    SAR0281
    MSHR1132:
    SAMSHR1132_02520
    MSSA476:
    SAS0260
    Mu3:
    SAHV_0282
    Mu50:
    SAV0284
    MW2:
    MW0260
    RF122:
    SAB0225
    ST398:
    SAPIG0299
    T0131:
    SAT0131_00280
    TCH60:
    HMPREF0772_10216 (essA)
    TW20:
    SATW20_02860 (essA)
    USA300_TCH1516:
    USA300HOU_0299 (essA)
    VC40:
    SAVC_01170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQK
    N315            MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKEVNDAIAKQK
    NCTC8325        MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQK
    Newman          MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQK
    USA300_FPR3757  MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQK
                    ************************************************** *********

    COL             KERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYIL
    N315            KERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYIL
    NCTC8325        KERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYIL
    Newman          KERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYIL
    USA300_FPR3757  KERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYIL
                    ************************************************************

    COL             MSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
    N315            MSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
    NCTC8325        MSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
    Newman          MSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
    USA300_FPR3757  MSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
                    ********************************