From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0404 [new locus tag: SA_RS02310 ]
  • pan locus tag?: SAUPAN002145000
  • symbol: lpl8
  • pan gene symbol?: lpl8
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0404 [new locus tag: SA_RS02310 ]
  • symbol: lpl8
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 463725..464507
  • length: 783
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAGTCTATAAAAAGGATTGGATTGTGCATAAGTCTGTTGATTTTAATCATTTTTGCA
    ACATCTTGTGGTAGTAATAAGATTACTGGAGACTCAAAAGAAGAACAAATCAAAAAGAGT
    TTTGCGAAATCTTTAGACAAGTATCCTACTGAAAATCTAGAAGAGTTTTATGATAAAGAA
    GGATATAGAGATGGAGAATTTGAAAAAGATGATAAAGGGACTTGGCTAATTAGATCTGAA
    ATGAAAATCCAATTAAAAGGAGAAAATCTGGAATCTAGGGGAGCAGTTATAGAAATTAAC
    AGAAATACTAGAACGGCTAAAGGGAATTATATTGTTAGAGAAGTTGTTGAAGATAGCGAT
    GGAATGACACACAATCATACAAAAAGGTATCCTGTGAAAATGGAAAATAATAAAATGATT
    CCATTAAAATCAATTGATGATGAAAAAGTAAAAAAAGAAATTGAAGAATTTAAATTCTTT
    GTACAATACGGGAATTTCAAAGAATTGGAAAACTATAAAGAGGACGAAGTGTCATATAAC
    CCAGAAGTACCAATATACTCTGCACAATATCAATTGAAAAACAGTGATTATAATGTAGAG
    CAATTACGTAAGCGATATAATATCCCGACGCAAAAAGCGCCCAAATTATTATTGAAAGGC
    TCAGGTAATTTAAAAGGTTCATCAGTCGGATATAAAAATATTGAATTTACCTTTGTTGAA
    AATAAGGAAGAAAATATTTACTTCACAGATAGTGTCTACTTTAATCCAAGCGAGGATAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0404 [new locus tag: SA_RS02310 ]
  • symbol: Lpl8
  • description: hypothetical protein
  • length: 260
  • theoretical pI: 6.57845
  • theoretical MW: 30311.1
  • GRAVY: -0.856154

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 347.8)
  • TheSEED:  
    FIG01107840: hypothetical protein 
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 417.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 4.6
    • Cellwall Score: 2.48
    • Extracellular Score: 2.92
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.409
    • Ymax_pos: 31
    • Cmax: 0.278
    • Cmax_pos: 31
    • Smax: 0.878
    • Smax_pos: 19
    • Smean: 0.684
    • D: 0.516
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKSIKRIGLCISLLILIIFATSCGSNKITGDSKEEQIKKSFAKSLDKYPTENLEEFYDKEGYRDGEFEKDDKGTWLIRSEMKIQLKGENLESRGAVIEINRNTRTAKGNYIVREVVEDSDGMTHNHTKRYPVKMENNKMIPLKSIDDEKVKKEIEEFKFFVQYGNFKELENYKEDEVSYNPEVPIYSAQYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFVENKEENIYFTDSVYFNPSEDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]