From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0478 [new locus tag: SA_RS02815 ]
  • pan locus tag?: SAUPAN002284000
  • symbol: SA0478
  • pan gene symbol?: pdxT
  • synonym:
  • product: glutamine amidotransferase subunit PdxT

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0478 [new locus tag: SA_RS02815 ]
  • symbol: SA0478
  • product: glutamine amidotransferase subunit PdxT
  • replicon: chromosome
  • strand: +
  • coordinates: 558489..559049
  • length: 561
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAATAGGTGTATTAGCATTACAAGGTGCAGTACGTGAACATATTAGACATATTGAA
    TTAAGTGGTCATGAAGGTATTGCAGTTAAAAAAGTTGAACAATTAGAAGAAATCGAGGGC
    TTAATATTACCTGGTGGCGAGTCTACAACGTTACGTCGATTAATGAATTTATATGGATTT
    AAAGAGGCTTTACAAAATTCAACTTTACCTATGTTTGGTACATGCGCAGGATTAATAGTT
    CTAGCGCAAGATATAGTTGGTGAAGAAGGATACCTTAACAAGTTGAATATTACTGTACAA
    CGAAACTCATTCGGTAGACAAGTTGACAGCTTTGAAACAGAATTAGATATTAAAGGTATC
    GCTACAGATATTGAAGGTGTCTTTATAAGAGCGCCACATATTGAAAAAGTAGGTCAAGGC
    GTAGATATCCTATGTAAGGTTAATGAGAAAATTGTAGCTGTCCAGCAAGGTAAATATTTA
    GGCGTATCATTCCATCCTGAATTAACAGATGACTATAGAGTAACTGATTACTTTATTAAT
    CATATTGTAAAAAAAGCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0478 [new locus tag: SA_RS02815 ]
  • symbol: SA0478
  • description: glutamine amidotransferase subunit PdxT
  • length: 186
  • theoretical pI: 5.94492
  • theoretical MW: 20629.7
  • GRAVY: -0.0225806

Function[edit source | edit]

  • reaction:
    EC 4.3.3.6?  ExPASy
    Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing)D-ribose 5-phosphate + D-glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
    EC 3.5.1.2?  ExPASy
    GlutaminaseL-glutamine + H2O = L-glutamate + NH3
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 269.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 27.9)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.3)
  • TheSEED:  
    Pyridoxin (Vitamin B6) Biosynthesis Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing), glutaminase subunit (EC 4.3.3.6) 
  • PFAM:
    Glutaminase_I (CL0014) SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 230.6)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 27.2)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 25.4)
    Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 17.1)
    no clan definedDUF169; Uncharacterised ArCR, COG2043 (PF02596; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 24
    • Cmax: 0.106
    • Cmax_pos: 31
    • Smax: 0.14
    • Smax_pos: 18
    • Smean: 0.105
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGFKEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGIATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFINHIVKKA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA0476
    SA0476 (TF) important in Pyridoxine biosynthesisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]