From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002284000
  • symbol?: pdxT
  • description?: glutamine amidotransferase subunit PdxT

      descriptions from strain specific annotations:

    • glutamine amidotransferase subunit PdxT
    • pyridoxal 5'-phosphate synthase glutaminase subunit PdxT
    • pyridoxine biosynthesis amidotransferase
    • Pyridoxine biosynthesis glutamineamidotransferase, glutaminase subunit
    • glutamine amidotransferase subunit PdxT (Glutamineamidotransferase glutaminase subunit pdxT)
    • pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
    • SNO glutamine amidotransferase family protein
  • strand?: +
  • coordinates?: 2806487..2807047
  • synteny block?: BlockID0015830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0495
    08BA02176:
    C248_0591
    11819-97:
    MS7_0509 (pdxT)
    71193:
    ST398NM01_0595
    ECT-R 2:
    ECTR2_473
    ED133:
    SAOV_0555
    ED98:
    SAAV_0481
    HO 5096 0412:
    SAEMRSA15_04460
    JH1:
    SaurJH1_0556
    JH9:
    SaurJH9_0542
    JKD6008:
    SAA6008_00526
    JKD6159:
    SAA6159_00473
    LGA251:
    SARLGA251_04540
    M013:
    M013TW_0504
    MRSA252:
    SAR0523
    MSHR1132:
    SAMSHR1132_04640
    MSSA476:
    SAS0477
    Mu3:
    SAHV_0517
    Mu50:
    SAV0520
    MW2:
    MW0475
    RF122:
    SAB0470
    ST398:
    SAPIG0595
    T0131:
    SAT0131_00569
    TCH60:
    HMPREF0772_12671
    TW20:
    SATW20_05880
    USA300_TCH1516:
    USA300HOU_0512
    VC40:
    SAVC_02185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
    N315            MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
    NCTC8325        MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
    Newman          MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
    USA300_FPR3757  MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
                    ************************************************************

    COL             KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
    N315            KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
    NCTC8325        KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
    Newman          KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
    USA300_FPR3757  KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
                    ************************************************************

    COL             ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
    N315            ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
    NCTC8325        ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
    Newman          ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
    USA300_FPR3757  ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
                    ************************************************************

    COL             HIVKKA
    N315            HIVKKA
    NCTC8325        HIVKKA
    Newman          HIVKKA
    USA300_FPR3757  HIVKKA
                    ******