From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
  • pan locus tag?: SAUPAN002284000
  • symbol: SACOL0565
  • pan gene symbol?: pdxT
  • synonym:
  • product: glutamine amidotransferase subunit PdxT

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
  • symbol: SACOL0565
  • product: glutamine amidotransferase subunit PdxT
  • replicon: chromosome
  • strand: +
  • coordinates: 585856..586416
  • length: 561
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAATAGGTGTATTAGCATTACAAGGTGCAGTACGTGAACATATTAGACATATTGAA
    TTAAGTGGTCATGAAGGTATTGCAGTTAAAAAAGTTGAACAATTAGAAGAAATCGAGGGC
    TTAATATTACCTGGTGGCGAGTCTACAACGTTACGTCGATTAATGAATTTATATGGATTT
    AAAGAGGCTTTACAAAATTCAACTTTACCTATGTTTGGTACATGCGCAGGATTAATAGTT
    CTAGCGCAAGATATAGTTGGTGAAGAAGGATACCTTAACAAGTTGAATATTACTGTACAA
    CGAAACTCATTCGGTAGACAAGTTGACAGCTTTGAAACAGAATTAGATATTAAAGGTATC
    GCTACAGATATTGAAGGTGTCTTTATAAGAGCCCCACATATTGAAAAAGTAGGTCAAGGC
    GTAGATATCCTATGTAAGGTTAATGAGAAAATTGTAGCTGTTCAGCAAGGTAAATATTTA
    GGCGTATCATTCCATCCTGAATTAACAGATGACTATAGAGTAACTGATTACTTTATTAAT
    CATATTGTAAAAAAAGCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0565 [new locus tag: SACOL_RS02935 ]
  • symbol: SACOL0565
  • description: glutamine amidotransferase subunit PdxT
  • length: 186
  • theoretical pI: 5.94492
  • theoretical MW: 20629.7
  • GRAVY: -0.0225806

Function[edit source | edit]

  • reaction:
    EC 4.3.3.6?  ExPASy
    Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing)D-ribose 5-phosphate + D-glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
    EC 3.5.1.2?  ExPASy
    GlutaminaseL-glutamine + H2O = L-glutamate + NH3
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 269.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 27.9)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.3)
  • TheSEED:  
    Pyridoxin (Vitamin B6) Biosynthesis Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing), glutaminase subunit (EC 4.3.3.6) 
  • PFAM:
    Glutaminase_I (CL0014) SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 230.6)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 27.2)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 25.4)
    Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 17.1)
    no clan definedDUF169; Uncharacterised ArCR, COG2043 (PF02596; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 24
    • Cmax: 0.106
    • Cmax_pos: 31
    • Smax: 0.14
    • Smax_pos: 18
    • Smean: 0.105
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGFKEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGIATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFINHIVKKA

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 670 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 50.91 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]