From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0515 [new locus tag: SA_RS03005 ]
  • pan locus tag?: SAUPAN002330000
  • symbol: SA0515
  • pan gene symbol?: dgk
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0515 [new locus tag: SA_RS03005 ]
  • symbol: SA0515
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 602028..602645
  • length: 618
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAACCTTTTATAGCAATTGAAGGTCCTATTGGCGTAGGTAAATCTTCACTTGCA
    CACAAATTAAGTCAAACTTTAGATTTTTATGAAGAAAAAGAAATCATCACAGAAAATCCA
    TTTTTATCAGACTTTTATGAAGATATCTCTAAATGGAGTTTTCAAACTGAAATGTTCTTT
    TTATGCAATAGATATAAGCAATTTCAAGATGTAACACAACTAAATCAAGGTGTAGTTAGT
    GATTATCATATACATAAAAATAAGATATTTGCTAAAAATACTTTGAGTCCTGTTGAATTT
    CAGAAATTCAGTAAAATTTATGATATTTTAACTGAAGATATGATTATGCCGAATATGATT
    ATCTTTTTAGATGCAGACCTTGATGTGTTAAAATCTAGAATTGCTAAACGTAACCGTAGT
    TTTGAGCATCAAATAGAAGATGAATATCTGTTAAAGTTAAAAAAAGATTATCGTGAGTAT
    TATGAGTCCTTACAAAGTAATGGTTCAAATGTAGTTTTAATCGATACAACTTCTATTGAT
    TTTCTTAAAAATGAACAAGATTACGAAGATATATTACATATTATATTACCTATGATAGGA
    GATATTACCAATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0515 [new locus tag: SA_RS03005 ]
  • symbol: SA0515
  • description: hypothetical protein
  • length: 205
  • theoretical pI: 4.5954
  • theoretical MW: 24163.3
  • GRAVY: -0.380976

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 42.9)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 25)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 20.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 16)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 12.3)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesPurine conversions Deoxyguanosine kinase (EC 2.7.1.113) 
  • PFAM:
    P-loop_NTPase (CL0023) dNK; Deoxynucleoside kinase (PF01712; HMM-score: 157.1)
    Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 36.3)
    AAA_18; AAA domain (PF13238; HMM-score: 34.6)
    AAA_33; AAA domain (PF13671; HMM-score: 28.7)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 18.7)
    SKI; Shikimate kinase (PF01202; HMM-score: 17.9)
    AAA_22; AAA domain (PF13401; HMM-score: 17.7)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.4)
    AAA_17; AAA domain (PF13207; HMM-score: 15.2)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.1)
    AAA_14; AAA domain (PF13173; HMM-score: 14.6)
    ATP_bind_2; P-loop ATPase protein family (PF03668; HMM-score: 14.1)
    ABC_tran; ABC transporter (PF00005; HMM-score: 13.8)
    AAA_28; AAA domain (PF13521; HMM-score: 13.6)
    NACHT; NACHT domain (PF05729; HMM-score: 12.8)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 20
    • Cmax: 0.112
    • Cmax_pos: 20
    • Smax: 0.222
    • Smax_pos: 19
    • Smean: 0.158
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDFYEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSPVEFQKFSKIYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQSNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]