From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002330000
  • symbol?: dgk
  • description?: deoxynucleoside kinase

      descriptions from strain specific annotations:

    • deoxynucleoside kinase
    • deoxynucleoside kinase family protein
    • Deoxyadenosine kinase / Deoxyguanosine kinase
    • deoxyadenosine kinase
    • deoxyguanosine kinase
    • deoxypurine kinase
    • deoxypurine kinase subunit
    • putative deoxyadenosine kinase protein
  • strand?: -
  • coordinates?: 2850329..2850946
  • synteny block?: BlockID0016290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0534
    08BA02176:
    C248_0632
    11819-97:
    MS7_0547 (dgk)
    71193:
    ST398NM01_0632
    ECT-R 2:
    ECTR2_511
    ED133:
    SAOV_0592c
    ED98:
    SAAV_0520
    HO 5096 0412:
    SAEMRSA15_04840
    JH1:
    SaurJH1_0594
    JH9:
    SaurJH9_0580
    JKD6008:
    SAA6008_00564
    JKD6159:
    SAA6159_00511
    LGA251:
    SARLGA251_04930
    M013:
    M013TW_0544
    MRSA252:
    SAR0562
    MSHR1132:
    SAMSHR1132_05010
    MSSA476:
    SAS0515
    Mu3:
    SAHV_0555
    Mu50:
    SAV0557
    MW2:
    MW0512
    RF122:
    SAB0508c
    ST398:
    SAPIG0632
    T0131:
    SAT0131_00611
    TCH60:
    HMPREF0772_12632
    TW20:
    SATW20_06270
    USA300_TCH1516:
    USA300HOU_0551
    VC40:
    SAVC_02380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
    N315            ---------------MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
    NCTC8325        ---------------MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
    Newman          MVQYSMSILTFGDVNMNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
    USA300_FPR3757  ---------------MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
                                   *********************************************

    COL             YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFSK
    N315            YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSPVEFQKFSK
    NCTC8325        YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFSK
    Newman          YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFSK
    USA300_FPR3757  YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFSK
                    ***************************************************.********

    COL             IYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQ
    N315            IYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQ
    NCTC8325        IYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQ
    Newman          IYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQ
    USA300_FPR3757  IYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQ
                    ************************************************************

    COL             SNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE
    N315            SNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE
    NCTC8325        SNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE
    Newman          SNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE
    USA300_FPR3757  SNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE
                    ****************************************