From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0665 [new locus tag: SA_RS03790 ]
  • pan locus tag?: SAUPAN002596000
  • symbol: SA0665
  • pan gene symbol?: queE
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0665 [new locus tag: SA_RS03790 ]
  • symbol: SA0665
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 759215..759928
  • length: 714
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAAATTCCTGTACTCGAAATATTCGGTCCAACCATTCAGGGTGAAGGTCGAGTA
    ATCGGTAGAAAAACGATGTTTGTGAGAACAGCTGGATGTGATTATCGCTGTAGCTGGTGT
    GATTCTGCATTTACTTGGGATGGTAGTGCTAAAGGCGATATAAAACTCATGACCGCTGAA
    GAAATTTATGATGAATTAAAACGAATTGGTGGCGATTTATTTAATCACGTTACAATTTCT
    GGTGGTAACCCAGCATTAATTAAAGGTATCCAAGAGTTAGTTGACTTATTTCAAGATAAA
    GGTATTTTCAGCGCACTGGAGACACAAGGCAGTAAATTCCAACCTTGGATGACACAAATT
    GATGATTTAACGATTAGTCCAAAACCACCAAGTTCAACTATGACACCTGATTTAAAAAAG
    TTAGATGAAGTGATTACACAATGCGTACCTTCCTCATTAAACTTAAAAGTAGTTGTATTC
    GACGATAAAGATTATGATTTTGCCAAAATGATACACCACCGTTATCCAGATATTCCCTTC
    TATTTACAAGTTGGTAACCCATATTTATCAGACAGCGTAGATAATCATACCGAAAAGTTG
    TTAGAACGCTACGAGCAGTTGGTGGATTTAGTTATGCAAAGTAATGATATGAATCACGTT
    TATGTGTTACCACAACTTCATACATTACTTTGGAGTAATAAAAAAGGTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0665 [new locus tag: SA_RS03790 ]
  • symbol: SA0665
  • description: hypothetical protein
  • length: 237
  • theoretical pI: 5.10847
  • theoretical MW: 26820.6
  • GRAVY: -0.253587

Function[edit source | edit]

  • reaction:
    EC 4.3.99.3?  ExPASy
    7-carboxy-7-deazaguanine synthase6-carboxy-5,6,7,8-tetrahydropterin = 7-carboxy-7-carbaguanine + NH3
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 382.7)
    Genetic information processingProtein synthesistRNA and rRNA base modificationputative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 93.4)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 77.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04322; HMM-score: 55.2)
    7-carboxy-7-deazaguanine synthase (TIGR04508; EC 4.3.99.3; HMM-score: 46.8)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Genetic information processingProtein fateProtein modification and repairpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    MetabolismEnergy metabolismAnaerobicpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 21)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 19)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinprobable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 19)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 19)
    Unknown functionEnzymes of unknown specificitymycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 18.8)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 18.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 18.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 18)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 17.6)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 16.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 16.4)
    Unknown functionEnzymes of unknown specificityY_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 16.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 16.2)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 15.4)
    selenobiotic family peptide radical SAM maturase (TIGR04082; HMM-score: 15.4)
    Genetic information processingProtein fateProtein modification and repair[benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 14.9)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 14)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 13.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 12.7)
    putative peptide-modifying radical SAM enzyme, Mhun_1560 family (TIGR04083; HMM-score: 12.7)
  • TheSEED:  
    Queuosine-Archaeosine Biosynthesis 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3) 
  • PFAM:
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 46.1)
    4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 36.3)
    Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 33.3)
    no clan definedHistone_H2A_C; C-terminus of histone H2A (PF16211; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, S-adenosyl-L-methionine, [4Fe-4S] cluster
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.107
    • Ymax_pos: 23
    • Cmax: 0.141
    • Cmax_pos: 53
    • Smax: 0.126
    • Smax_pos: 22
    • Smean: 0.097
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAEEIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQIDDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPFYLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: PreQ1
    PreQ1 (RNA) important in Queuosine biosynthesisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]