From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0683 [new locus tag: SA_RS03895 ]
  • pan locus tag?: SAUPAN002626000
  • symbol: SA0683
  • pan gene symbol?: queF
  • synonym:
  • product: 7-cyano-7-deazaguanine reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0683 [new locus tag: SA_RS03895 ]
  • symbol: SA0683
  • product: 7-cyano-7-deazaguanine reductase
  • replicon: chromosome
  • strand: -
  • coordinates: 780923..781423
  • length: 501
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCACATGGCCGTCAACAAGATGAATTACAAGATATAACTTTATTAGGAAATCAAGAC
    AATACTTACAATTTTGACTATCGTCCTGATGTATTAGAATCGTTTGATAATAAGCATCAA
    GGTCGTGACTATTTCGTAAAATTCAACTGTCCAGAATTTACATCATTATGTCCAATTACT
    GGGCAACCAGATTTTGCAACTATCTATATTTCATATATTCCAAATGTTAAAATGGTTGAA
    TCAAAATCTTTGAAATTATACTTATTTAGTTTCAGAAATCACGGTGATTTTCACGAAGAT
    TGTATGAATATTATTATGAATGATTTGATAGAGCTTATGGACCCACATTATATTGAAGTC
    TGGGGCAAGTTCACACCACGTGGTGGAATTTCTATTGATCCTTATACAAACTATGGACGT
    CCAAATTCTAAATATGAAAAAATGGCTGAGCATCGTTTGATGAATCATGATTTATATCCC
    GAAAAAATAGATAATCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0683 [new locus tag: SA_RS03895 ]
  • symbol: SA0683
  • description: 7-cyano-7-deazaguanine reductase
  • length: 166
  • theoretical pI: 5.23642
  • theoretical MW: 19645
  • GRAVY: -0.715663

Function[edit source | edit]

  • reaction:
    EC 1.7.1.13?  ExPASy
    PreQ1 synthase7-aminomethyl-7-carbaguanine + 2 NADP+ = 7-cyano-7-carbaguanine + 2 NADPH
  • TIGRFAM:
    7-cyano-7-deazaguanine reductase (TIGR03139; EC 1.7.1.13; HMM-score: 177.6)
    Genetic information processingTranscriptionRNA processingqueuine synthase (TIGR03138; EC 1.7.1.13; HMM-score: 82.1)
  • TheSEED:  
    Queuosine-Archaeosine Biosynthesis NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) 
  • PFAM:
    THBO-biosyn (CL0334) QueF; QueF-like protein (PF14489; HMM-score: 120.4)
    QueF_N; Nitrile reductase, 7-cyano-7-deazaguanine-reductase N-term (PF14819; HMM-score: 23.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 67
    • Cmax: 0.14
    • Cmax_pos: 67
    • Smax: 0.125
    • Smax_pos: 39
    • Smean: 0.084
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: LexA
    LexA (TF) important in SOS response  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]