From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1174 [new locus tag: SA_RS06675 ]
  • pan locus tag?: SAUPAN003714000
  • symbol: lexA
  • pan gene symbol?: lexA
  • synonym:
  • product: LexA repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1174 [new locus tag: SA_RS06675 ]
  • symbol: lexA
  • product: LexA repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1337131..1337754
  • length: 624
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGAGAATTAACAAAACGACAAAGCGAAATATATAACTATATTAAACAAGTTGTTCAA
    ATGAAAGGTTATCCGCCTAGTGTTCGCGAAATTGGTGAAGCAGTTGGCTTAGCATCCAGT
    TCAACTGTTCATGGTCATCTTTCACGTCTTGAAGAAAAAGGATATATAAGAAGAGATCCA
    ACGAAACCACGTGCTATAGAAATTGTAAGTGATCAAACAAATGATAATATTAATATGGAA
    GAAACGATTCATGTGCCAGTTATTGGTAAAGTCACAGCAGGTGTTCCTATTACCGCTGTA
    GAAAATATTGAAGAGTATTTTCCATTACCTGAACACTTAACATCGACACATAATAGCGAC
    ATATTCATATTAAACGTCGTAGGCGACAGTATGATTGAGGCTGGTATATTAGACGGAGAC
    AAAGTAATTGTTCGCAGTCAAACCATAGCAGAAAATGGAGACATTATTGTTGCTATGACT
    GAGGAAGATGAAGCAACTGTCAAACGCTTCTATAAAGAAAAAAATCGTTATCGATTACAA
    CCTGAAAATAGTACAATGGAGCCAATTTACCTCGACAATGTTGCTGTAATTGGGAAAGTA
    ATTGGTTTGTACCGCGAAATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1174 [new locus tag: SA_RS06675 ]
  • symbol: LexA
  • description: LexA repressor
  • length: 207
  • theoretical pI: 4.88134
  • theoretical MW: 23331.4
  • GRAVY: -0.345411

Function[edit source | edit]

  • reaction:
    EC 3.4.21.88?  ExPASy
    Repressor LexAHydrolysis of Ala-|-Gly bond in repressor LexA
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 249.7)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 249.7)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.1)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial UmuCD system SOS-response repressor and protease LexA (EC 3.4.21.88) 
    DNA repairDNA repair, bacterial SOS-response repressor and protease LexA (EC 3.4.21.88) 
  • PFAM:
    HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 96.9)
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 65.6)
    HTH (CL0123) HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 24)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23)
    MarR_2; MarR family (PF12802; HMM-score: 19.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.6)
    MarR; MarR family (PF01047; HMM-score: 17)
    HTH_11; HTH domain (PF08279; HMM-score: 14.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.3)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.2)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.2)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 13.9)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.7)
    no clan definedKfrA_N; Plasmid replication region DNA-binding N-term (PF11740; HMM-score: 13.4)
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.3)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.6)
    no clan definedCobN-Mg_chel; CobN/Magnesium Chelatase (PF02514; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 35
    • Cmax: 0.119
    • Cmax_pos: 51
    • Smax: 0.192
    • Smax_pos: 32
    • Smean: 0.122
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRELTKRQSEIYNYIKQVVQMKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQPENSTMEPIYLDNVAVIGKVIGLYREM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • lexA no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: LexA
    LexA (TF) important in SOS response  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]