From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • pan locus tag?: SAUPAN003714000
  • symbol: lexA
  • pan gene symbol?: lexA
  • synonym:
  • product: LexA repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • symbol: lexA
  • product: LexA repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1378832..1379455
  • length: 624
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGAGAATTAACAAAACGACAAAGCGAAATATATAACTATATTAAACAAGTTGTTCAA
    ACGAAAGGTTATCCGCCTAGTGTTCGCGAAATTGGTGAAGCAGTTGGCTTAGCATCCAGT
    TCAACTGTTCATGGTCACCTTTCACGTCTTGAAGAAAAAGGCTATATAAGAAGAGATCCA
    ACGAAACCACGTGCTATAGAAATTGTAAGTGATCAAACAAATGATAATATTAATATGGAA
    GAAACGATTCATGTGCCAGTTATTGGTAAAGTCACAGCAGGTGTTCCTATTACCGCAGTA
    GAAAATATTGAAGAATATTTTCCATTACCTGAACACTTAACATCGACACACAATAGCGAC
    ATATTCATATTAAACGTCGTAGGCGACAGTATGATTGAGGCTGGTATATTAGACGGAGAC
    AAAGTAATTGTTCGCAGTCAAACCATAGCAGAAAATGGAGACATTATTGTTGCTATGACT
    GAGGAAGATGAAGCAACTGTCAAACGCTTCTATAAAGAAAAAAATCGTTATCGATTACAA
    CCTGAAAATAGTACAATGGAGCCAATTTACCTAGACAATGTTGCTGTAATTGGGAAAGTA
    ATTGGTTTGTACCGCGAAATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • symbol: LexA
  • description: LexA repressor
  • length: 207
  • theoretical pI: 4.88134
  • theoretical MW: 23301.3
  • GRAVY: -0.357971

Function[edit source | edit]

  • reaction:
    EC 3.4.21.88?  ExPASy
    Repressor LexAHydrolysis of Ala-|-Gly bond in repressor LexA
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.4)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial UmuCD system SOS-response repressor and protease LexA (EC 3.4.21.88) 
    DNA repairDNA repair, bacterial SOS-response repressor and protease LexA (EC 3.4.21.88) 
  • PFAM:
    HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 98.1)
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 65.2)
    HTH (CL0123) HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 24.3)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.1)
    MarR_2; MarR family (PF12802; HMM-score: 19.1)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.5)
    MarR; MarR family (PF01047; HMM-score: 17)
    HTH_11; HTH domain (PF08279; HMM-score: 16.4)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.2)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.2)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 13.9)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.5)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.5)
    no clan definedKfrA_N; Plasmid replication region DNA-binding N-term (PF11740; HMM-score: 13.4)
    HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.5)
    no clan definedCobN-Mg_chel; CobN/Magnesium Chelatase (PF02514; HMM-score: 10.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 35
    • Cmax: 0.119
    • Cmax_pos: 51
    • Smax: 0.19
    • Smax_pos: 7
    • Smean: 0.119
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQPENSTMEPIYLDNVAVIGKVIGLYREM

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 344 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • lexA no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: LexA
    LexA (TF) important in SOS response  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 3.42 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb. Drug Resist.: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] [DOI] (P p)