Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01333
- pan locus tag?: SAUPAN003714000
- symbol: SAOUHSC_01333
- pan gene symbol?: lexA
- synonym:
- product: LexA repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01333
- symbol: SAOUHSC_01333
- product: LexA repressor
- replicon: chromosome
- strand: -
- coordinates: 1275058..1275681
- length: 624
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920198 NCBI
- RefSeq: YP_499863 NCBI
- BioCyc: G1I0R-1247 BioCyc
- MicrobesOnline: 1289777 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGAGAATTAACAAAACGACAAAGCGAAATATATAACTATATTAAACAAGTTGTTCAA
ACGAAAGGTTATCCGCCTAGTGTTCGCGAAATTGGTGAAGCAGTTGGCTTAGCATCCAGT
TCAACTGTTCATGGTCACCTTTCACGTCTTGAAGAAAAAGGCTATATAAGAAGAGATCCA
ACGAAACCACGTGCTATAGAAATTGTAAGTGATCAAACAAATGATAATATTAATATGGAA
GAAACGATTCATGTGCCAGTTATTGGTAAAGTCACAGCAGGTGTTCCTATTACCGCAGTA
GAAAATATTGAAGAATATTTTCCATTACCTGAACACTTAACATCGACACACAATAGCGAC
ATATTCATATTAAACGTCGTAGGCGACAGTATGATTGAGGCTGGTATATTAGACGGAGAC
AAAGTAATTGTTCGCAGTCAAACCATAGCAGAAAATGGAGACATTATTGTTGCTATGACT
GAGGAAGATGAAGCAACTGTCAAACGCTTCTATAAAGAAAAAAATCGTTATCGATTACAA
CCTGAAAATAGTACAATGGAGCCAATTTACCTAGACAATGTTGCTGTAATTGGGAAAGTA
ATTGGTTTGTACCGCGAAATGTAA60
120
180
240
300
360
420
480
540
600
624
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01333
- symbol: SAOUHSC_01333
- description: LexA repressor
- length: 207
- theoretical pI: 4.88134
- theoretical MW: 23301.3
- GRAVY: -0.357971
⊟Function[edit | edit source]
- reaction: EC 3.4.21.88? ExPASyRepressor LexA Hydrolysis of Ala-|-Gly bond in repressor LexA
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)and 1 moreRegulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.4)
- TheSEED :
- SOS-response repressor and protease LexA (EC 3.4.21.88)
DNA Metabolism DNA repair DNA repair, bacterial SOS-response repressor and protease LexA (EC 3.4.21.88)and 1 more - PFAM: HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 98.1)and 16 morePeptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 65.2)HTH (CL0123) HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 24.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.1)MarR_2; MarR family (PF12802; HMM-score: 19.1)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.5)MarR; MarR family (PF01047; HMM-score: 17)HTH_11; HTH domain (PF08279; HMM-score: 16.4)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.2)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.2)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 13.9)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.5)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.5)no clan defined KfrA_N; Plasmid replication region DNA-binding N-term (PF11740; HMM-score: 13.4)HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.5)no clan defined CobN-Mg_chel; CobN/Magnesium Chelatase (PF02514; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- stimulus: DNA damage
- genes regulated by LexA*, TF important in SOS responseRegPrecisetranscription units transferred from N315 data RegPrecise
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011079
- TAT(Tat/SPI): 0.002754
- LIPO(Sec/SPII): 0.001561
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQPENSTMEPIYLDNVAVIGKVIGLYREM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [4] : SAOUHSC_01331 < S555 < SAOUHSC_01333
⊟Regulation[edit | edit source]
- regulator: LexA* (repression) regulon
LexA* (TF) important in SOS response; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]