From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00776
  • pan locus tag?: SAUPAN002672000
  • symbol: SAOUHSC_00776
  • pan gene symbol?: uvrB
  • synonym:
  • product: excinuclease ABC subunit B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00776
  • symbol: SAOUHSC_00776
  • product: excinuclease ABC subunit B
  • replicon: chromosome
  • strand: +
  • coordinates: 756470..757501
  • length: 1032
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGGTTGAACATTATCCTTTTAAAATACATTCTGATTTTGAGCCTCAAGGTGACCAACCG
    CAAGCAATTAAAGAAATCGTGGAAGGTATTAAAGCGGGGAAAAGACATCAAACTTTATTA
    GGTGCTACTGGCACAGGGAAAACATTTACGATGAGTAATGTTATTAAAGAAGTTGGGAAA
    CCAACGTTAATTATCGCGCATAACAAAACATTAGCAGGACAATTATATAGTGAGTTTAAA
    GAATTTTTTCCTGAAAACAGGGTGGAATACTTTGTAAGTTACTATGATTATTATCAACCA
    GAGGCATACGTACCGTCTACTGACACTTTTATTGAAAAAGATGCCTCAATCAATGATGAA
    ATTGATCAACTACGACATTCTGCTACAAGTGCATTATTTGAACGCGATGATGTAATTATT
    ATTGCTAGTGTAAGTTGTATATATGGTTTAGGTAATCCTGAAGAATATAAAGATTTAGTA
    GTAAGTGTTCGAGTTGGTATGGAAATGGATAGAAGTGAATTACTTAGAAAACTTGTAGAT
    GTGCAATATACACGAAATGACATCGATTTCCAACGAGGAACGTTTCGAGTGCGTGGTGAT
    GTAGTGGAAATATTCCCAGCCTCTAAAGAAGAACTTTGTATAAGGGTTGAGTTTTTCGGC
    GATGAGATTGACCGTATCCGAGAAGTTAACTACCTAACAGGTGAAGTGTTGAAAGAAAGA
    GAACATTTTGCGATATTCCCAGCTTCTCACTTCGTAACACGTGAAGAAAAGTTGAAAGTT
    GCGATTGAACGTATTGAAAAAGAATTGGAAGAACGATTGAAAGAATTACGAGATGAGAAT
    AAATTACTAGAAGCGCAAAGGTTAGAACAGCGTACCAACTATGATTTAGAAATGATGCGA
    GAGATGGGATTCTGTTCAGGAATTGAAAACTATTCCGTACATTTAACTTTGCGACCACTG
    GGTTCGACACCATATACTTTATTGGATTACTTTGGCGATGATTGGTTAGGGAAGGTGCGA
    ACAAGTCCCTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1032

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00776
  • symbol: SAOUHSC_00776
  • description: excinuclease ABC subunit B
  • length: 343
  • theoretical pI: 4.74824
  • theoretical MW: 39815.8
  • GRAVY: -0.468222

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 556.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairtranscription-repair coupling factor (TIGR00580; EC 3.6.1.-; HMM-score: 56.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairATP-dependent DNA helicase RecG (TIGR00643; EC 3.6.4.12; HMM-score: 18.5)
    DNA phosphorothioation system restriction enzyme (TIGR04095; HMM-score: 11.6)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 8.5)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, UvrABC system Excinuclease ABC subunit B 
  • PFAM:
    P-loop_NTPase (CL0023) ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 49.9)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 20.6)
    AAA_30; AAA domain (PF13604; HMM-score: 19.5)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.9)
    Kinesin; Kinesin motor domain (PF00225; HMM-score: 15.5)
    TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 14.5)
    Microtub_bd; Microtubule binding (PF16796; HMM-score: 14.3)
    DUF853; Bacterial protein of unknown function (DUF853) (PF05872; HMM-score: 14.2)
    DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 13.6)
    AAA_25; AAA domain (PF13481; HMM-score: 12.5)
    AAA_22; AAA domain (PF13401; HMM-score: 11.9)
    no clan definedRsa3; Ribosome-assembly protein 3 (PF14615; HMM-score: 8.6)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.108
    • Ymax_pos: 67
    • Cmax: 0.117
    • Cmax_pos: 58
    • Smax: 0.126
    • Smax_pos: 22
    • Smean: 0.086
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVEHYPFKIHSDFEPQGDQPQAIKEIVEGIKAGKRHQTLLGATGTGKTFTMSNVIKEVGKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYVPSTDTFIEKDASINDEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDEIDRIREVNYLTGEVLKEREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENKLLEAQRLEQRTNYDLEMMREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLGKVRTSP

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56

Relevant publications[edit source | edit]