From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00069
  • pan locus tag?: SAUPAN000909000
  • symbol: SAOUHSC_00069
  • pan gene symbol?: spa
  • synonym:
  • product: protein A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00069
  • symbol: SAOUHSC_00069
  • product: protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 73429..74979
  • length: 1551
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    TTGAAAAAGAAAAACATTTATTCAATTCGTAAACTAGGTGTAGGTATTGCATCTGTAACT
    TTAGGTACATTACTTATATCTGGTGGCGTAACACCTGCTGCAAATGCTGCGCAACACGAT
    GAAGCTCAACAAAATGCTTTTTATCAAGTCTTAAATATGCCTAACTTAAATGCTGATCAA
    CGCAATGGTTTTATCCAAAGCCTTAAAGATGATCCAAGCCAAAGTGCTAACGTTTTAGGT
    GAAGCTCAAAAACTTAATGACTCTCAAGCTCCAAAAGCTGATGCGCAACAAAATAACTTC
    AACAAAGATCAACAAAGCGCCTTCTATGAAATCTTGAACATGCCTAACTTAAACGAAGCG
    CAACGTAACGGCTTCATTCAAAGTCTTAAAGACGACCCAAGCCAAAGCACTAACGTTTTA
    GGTGAAGCTAAAAAATTAAACGAATCTCAAGCACCGAAAGCTGATAACAATTTCAACAAA
    GAACAACAAAATGCTTTCTATGAAATCTTGAATATGCCTAACTTAAACGAAGAACAACGC
    AATGGTTTCATCCAAAGCTTAAAAGATGACCCAAGCCAAAGTGCTAACCTATTGTCAGAA
    GCTAAAAAGTTAAATGAATCTCAAGCACCGAAAGCGGATAACAAATTCAACAAAGAACAA
    CAAAATGCTTTCTATGAAATCTTACATTTACCTAACTTAAACGAAGAACAACGCAATGGT
    TTCATCCAAAGCCTAAAAGATGACCCAAGCCAAAGCGCTAACCTTTTAGCAGAAGCTAAA
    AAGCTAAATGATGCTCAAGCACCAAAAGCTGACAACAAATTCAACAAAGAACAACAAAAT
    GCTTTCTATGAAATTTTACATTTACCTAACTTAACTGAAGAACAACGTAACGGCTTCATC
    CAAAGCCTTAAAGACGATCCTTCAGTGAGCAAAGAAATTTTAGCAGAAGCTAAAAAGCTA
    AACGATGCTCAAGCACCAAAAGAGGAAGACAATAACAAGCCTGGCAAAGAAGACAATAAC
    AAGCCTGGCAAAGAAGACAACAACAAGCCTGGTAAAGAAGACAACAACAAGCCTGGTAAA
    GAAGACAACAACAAGCCTGGCAAAGAAGACGGCAACAAGCCTGGTAAAGAAGACAACAAA
    AAACCTGGTAAAGAAGATGGCAACAAGCCTGGTAAAGAAGACAACAAAAAACCTGGTAAA
    GAAGACGGCAACAAGCCTGGCAAAGAAGATGGCAACAAACCTGGTAAAGAAGATGGTAAC
    GGAGTACATGTCGTTAAACCTGGTGATACAGTAAATGACATTGCAAAAGCAAACGGCACT
    ACTGCTGACAAAATTGCTGCAGATAACAAATTAGCTGATAAAAACATGATCAAACCTGGT
    CAAGAACTTGTTGTTGATAAGAAGCAACCAGCAAACCATGCAGATGCTAACAAAGCTCAA
    GCATTACCAGAAACTGGTGAAGAAAATCCATTCATCGGTACAACTGTATTTGGTGGATTA
    TCATTAGCCTTAGGTGCAGCGTTATTAGCTGGACGTCGTCGCGAACTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1551

Protein[edit source | edit]

Protein Data Bank: 1DEE
Protein Data Bank: 4Y4Y

General[edit source | edit]

  • locus tag: SAOUHSC_00069
  • symbol: SAOUHSC_00069
  • description: protein A
  • length: 516
  • theoretical pI: 5.37468
  • theoretical MW: 56436.8
  • GRAVY: -1.16298

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    gram-positive signal peptide, YSIRK family (TIGR01168; HMM-score: 34.5)
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 19.4)
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 17.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsbacillithiol biosynthesis deacetylase BshB2 (TIGR04000; EC 3.-.-.-; HMM-score: 8.8)
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionAdhesins in Staphylococcus Protein A, von Willebrand factor binding protein Spa 
  • PFAM:
    B_GA (CL0598) B; B domain (PF02216; HMM-score: 474.5)
    GA; GA module (PF01468; HMM-score: 53.5)
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 48.7)
    no clan definedYSIRK_signal; YSIRK type signal peptide (PF04650; HMM-score: 38.4)
    Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 38.3)
    Octapeptide; Octapeptide repeat (PF03373; HMM-score: 32.7)
    Dim_A_B_barrel (CL0032) DUF3291; Domain of unknown function (DUF3291) (PF11695; HMM-score: 16.4)
    no clan definedIFT43; Intraflagellar transport protein 43 (PF15305; HMM-score: 16.3)
    TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 14.9)
    no clan definedCLAMP; Flagellar C1a complex subunit C1a-32 (PF14769; HMM-score: 14.1)
    DUF148; Domain of unknown function DUF148 (PF02520; HMM-score: 10.3)
    NTS_2; N-terminal segments of P. falciparum erythrocyte membrane protein (PF15448; HMM-score: 9.6)
    Met_repress (CL0057) DUF1778; Protein of unknown function (DUF1778) (PF08681; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SAOUHSC_02494(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SAOUHSC_00530elongation factor Tu  [1] (data from MRSA252)
    SAOUHSC_01794glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    SAOUHSC_01819hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 9.98
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: LPxTG Cell-wall anchored
    • Prediction by SwissProt Classification: Cell Wall
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: found LPxTG motif :LPETG
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.746
    • Ymax_pos: 37
    • Cmax: 0.674
    • Cmax_pos: 37
    • Smax: 0.91
    • Smax_pos: 27
    • Smean: 0.78
    • D: 0.759
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

T J Foster, M Höök
Surface protein adhesins of Staphylococcus aureus.
Trends Microbiol.: 1998, 6(12);484-8
[PubMed:10036727] [WorldCat.org] (P p)
M Graille, E A Stura, A L Corper, B J Sutton, M J Taussig, J B Charbonnier, G J Silverman
Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
Proc. Natl. Acad. Sci. U.S.A.: 2000, 97(10);5399-404
[PubMed:10805799] [WorldCat.org] (P p)
Tanusree Das, Chhabinath Mandal, Chitra Mandal
Protein A--a new ligand for human C-reactive protein.
FEBS Lett.: 2004, 576(1-2);107-13
[PubMed:15474020] [WorldCat.org] [DOI] (P p)
Satoshi Sato, Tomasz L Religa, Alan R Fersht
Phi-analysis of the folding of the B domain of protein A using multiple optical probes.
J. Mol. Biol.: 2006, 360(4);850-64
[PubMed:16782128] [WorldCat.org] [DOI] (P p)
K Garbacz, L Piechowicz, J Galiński
[Characteristics of clumping factor- and protein A-negative methicillin-resistant Staphylococcus aureus identified in Poland]. [Caractéristiques des souches de Staphylococcus aureus facteur agglutinant- et protéine- A-négatifs résistants à la méthicilline isolées en Pologne.]
Med Mal Infect: 2006, 36(9);469-72
[PubMed:17011150] [WorldCat.org] [DOI] (P p)
Marisa I Gómez, Maghnus O Seaghdha, Alice S Prince
Staphylococcus aureus protein A activates TACE through EGFR-dependent signaling.
EMBO J.: 2007, 26(3);701-9
[PubMed:17255933] [WorldCat.org] [DOI] (P p)
Andrea C DeDent, Molly McAdow, Olaf Schneewind
Distribution of protein A on the surface of Staphylococcus aureus.
J. Bacteriol.: 2007, 189(12);4473-84
[PubMed:17416657] [WorldCat.org] [DOI] (P p)
F Huang, E Lerner, S Sato, D Amir, E Haas, A R Fersht
Time-resolved fluorescence resonance energy transfer study shows a compact denatured state of the B domain of protein A.
Biochemistry: 2009, 48(15);3468-76
[PubMed:19222162] [WorldCat.org] [DOI] (I p)
Mark J J B Sibbald, Theresa Winter, Magdalena M van der Kooi-Pol, G Buist, E Tsompanidou, Tjibbe Bosma, Tina Schäfer, Knut Ohlsen, Michael Hecker, Haike Antelmann, Susanne Engelmann, Jan Maarten van Dijl
Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.
J. Bacteriol.: 2010, 192(14);3788-800
[PubMed:20472795] [WorldCat.org] [DOI] (I p)
Hwan Keun Kim, Vilasack Thammavongsa, Olaf Schneewind, Dominique Missiakas
Recurrent infections and immune evasion strategies of Staphylococcus aureus.
Curr. Opin. Microbiol.: 2012, 15(1);92-9
[PubMed:22088393] [WorldCat.org] [DOI] (I p)
Samuel Becker, Matthew B Frankel, Olaf Schneewind, Dominique Missiakas
Release of protein A from the cell wall of Staphylococcus aureus.
Proc. Natl. Acad. Sci. U.S.A.: 2014, 111(4);1574-9
[PubMed:24434550] [WorldCat.org] [DOI] (I p)
M Uhlén, B Guss, B Nilsson, S Gatenbeck, L Philipson, M Lindberg
Complete sequence of the staphylococcal gene encoding protein A. A gene evolved through multiple duplications.
J. Biol. Chem.: 1984, 259(3);1695-702
[PubMed:6319407] [WorldCat.org] (P p)
S Löfdahl, B Guss, M Uhlén, L Philipson, M Lindberg
Gene for staphylococcal protein A.
Proc. Natl. Acad. Sci. U.S.A.: 1983, 80(3);697-701
[PubMed:6338496] [WorldCat.org] (P p)