From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000909000
  • symbol?: spa
  • description?: peptidoglycan-binding protein LysM

      descriptions from strain specific annotations:

    • peptidoglycan-binding protein LysM
    • immunoglobulin G binding protein A
    • immunoglobulin G binding protein A precursor
    • protein A
    • immunoglobulin G binding protein A precursor (protein A)
    • Protein A, von Willebrand factor binding protein Spa
    • cell wall anchor domain-containing protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • pseudogene
  • strand?: -
  • coordinates?: 1175771..1177923
  • synteny block?: BlockID0004460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0095 (spa)
    N315:
    SA0107 (spa)
    NCTC8325:
    Newman:
    NWMN_0055 (spa)
    USA300_FPR3757:
    04-02981:
    SA2981_0112 (spa)
    08BA02176:
    C248_0099 (spa)
    11819-97:
    MS7_0103 (spa)
    71193:
    ST398NM01_0122
    ECT-R 2:
    ECTR2_67
    ED133:
    SAOV_0058 (spa)
    ED98:
    SAAV_0078 (spa)
    HO 5096 0412:
    SAEMRSA15_00770 (spa)
    JH1:
    SaurJH1_0102
    JH9:
    SaurJH9_0098
    JKD6008:
    SAA6008_00089
    JKD6159:
    SAA6159_00094
    LGA251:
    SARLGA251_00860 (spa)
    M013:
    M013TW_0101
    MRSA252:
    SAR0114 (spa)
    MSHR1132:
    SAMSHR1132_00870
    MSSA476:
    SAS0085
    Mu3:
    SAHV_0110 (spa)
    Mu50:
    SAV0111 (spa)
    MW2:
    MW0084 (spa)
    RF122:
    SAB0050c (spa)
    ST398:
    SAPIG0122
    T0131:
    SAT0131_00096
    TCH60:
    HMPREF0772_10386 (spa)
    TW20:
    SATW20_01230 (spa)
    USA300_TCH1516:
    USA300HOU_0122 (spa)
    VC40:
    SAVC_00295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFY
    N315            ------------MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFY
    NCTC8325        ------------MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFY
    Newman          MMTLQIHTGGINLKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFY
    USA300_FPR3757  ------------MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFY
                                :***********************************************

    COL             QVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAF
    N315            QVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAF
    NCTC8325        QVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAF
    Newman          QVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAF
    USA300_FPR3757  QVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAF
                    ************************************************************

    COL             YEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYE
    N315            YEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYE
    NCTC8325        YEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYE
    Newman          YEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYE
    USA300_FPR3757  YEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYE
                    ************************************************************

    COL             ILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEIL
    N315            ILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEIL
    NCTC8325        ILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEIL
    Newman          ILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEIL
    USA300_FPR3757  ILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEIL
                    ************************************************************

    COL             HLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHL
    N315            HLPNLN------------------------------------------------------
    NCTC8325        HLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHL
    Newman          HLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHL
    USA300_FPR3757  HLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHL
                    ******                                                      

    COL             PNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKE--------EDNNKPGKEDNN
    N315            ----EEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKE--------EDNKKPGKEDGN
    NCTC8325        PNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNN
    Newman          PNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKE--------EDNNKPGKEDNN
    USA300_FPR3757  PNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKE--------EDNNKPGKEDNN
                        ************************************        ***:******.*

    COL             KPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGK
    N315            KPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGK
    NCTC8325        KPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGK
    Newman          KPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGK
    USA300_FPR3757  KPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGK
                    ******.********:***************:***************:************

    COL             EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKK
    N315            EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKK
    NCTC8325        EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKK
    Newman          EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKK
    USA300_FPR3757  EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKK
                    ************************************************************

    COL             QPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
    N315            QPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
    NCTC8325        QPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
    Newman          QPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
    USA300_FPR3757  QPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
                    ************************************************